KEGG   Monodelphis domestica (opossum): 100030263Help
Entry
100030263         CDS       T01031                                 

Definition
chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     100030263
Peptidases [BR:mdo01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100030263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 383 aa AA seqDB search
MRVLLFLLAVIAISECAFRRIPLTKGKTLRKVLKEHGLLESFLKSHKYSPSSKYQLYGEA
AKVTDEPLTNYLDSQYFGKIYIGTPPQEFTVVFDTGSSNLWVPSVYCNSDACQNHHRFNP
ASSTTFRSTQEPLSIQYGTGSMEGVLGYDTVTVSQIVVPDQIFGLSTQEPGEIFTYSEFD
GILGLGYPSLAEDQATPVFDNMMNKNLVAQDLFSVYMSRDSQGSMLILGAIDPSYYTGSL
HWVPVTEQGYWQFSVDSITVNGQVVACEGGCQAILDTGTSLLVGPSYDIANIQSIIGATQ
GQYGEYDINCSNLSSMPTVVVHINGRQYPLPPSAYTNQDQGLCSSGFQSEGSDQLWILGD
VFIREYYSVFDRGNNRVGLATAV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagggttcttctgttcctccttgcggtcatcgccatctccgaatgtgccttcagaagg
ataccgctgacgaaagggaagacactaagaaaggtgctaaaggaacatggattgttggaa
agctttctgaagagtcataagtattcccccagctctaagtaccagctctatggtgaagct
gccaaggttacagatgagcccttgaccaattacctggatagtcagtactttgggaagatt
tacatcggaaccccaccccaggagttcactgtggtgttcgatactggctcctctaatctc
tgggtcccctcagtctactgtaacagtgatgcctgccaaaaccaccacagattcaaccca
gcttcctccaccactttccggagcactcaggaacctctgtccatccagtatggcactggc
agcatggaaggagtcctgggctatgatactgtgactgtctctcagattgtggtccctgac
cagatctttggcctgagcactcaagagcctggtgaaatctttacctattctgaatttgat
ggaatcttgggactgggctacccctccttggctgaagatcaggccacccctgtctttgac
aacatgatgaataagaacttggtagcccaggatctcttctctgtttatatgagcagggat
agccagggcagcatgctcatccttggggccatcgacccatcttactacactggctccctc
cactgggtccctgtcacagagcagggctactggcagttctccgtggacagcatcactgtc
aatggccaggtggtggcttgtgaaggtggctgccaggccatcttggatactggcacctct
ctcttggtgggtccaagctatgacattgccaacatccagagcatcattggagctacccag
ggccaatatggagagtatgacatcaactgcagcaacctgagctccatgcctacagtcgtg
gtgcacatcaatggcagacagtaccctctccctccctcagcctacacgaatcaggaccag
ggactgtgttccagtggcttccagagtgaaggcagtgaccagctgtggatccttggagat
gtcttcatccgagaatactacagcgtctttgacaggggcaacaaccgcgtgggcttggcc
acagcagtctga

DBGET integrated database retrieval system