KEGG   Monodelphis domestica (opossum): 100030405Help
Entry
100030405         CDS       T01031                                 

Gene name
CAPN1
Definition
calpain 1, (mu/I) large subunit
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100030405 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100030405 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100030405 (CAPN1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100030405 (CAPN1)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C2: calpain family
   100030405 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 681 aa AA seqDB search
MTEEIITPVYCTGVSAQVKKQRAKDLGLGSHENSIKYLGQDYDQLRSQYLQAGVLFQDET
FPPSPHSLGFKELGPNSSKIYGVKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASITLNEPILHRVVPHGQSFQDGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWFNLRKPPQDLYQIILK
ALERGSLLGCSIDVSLLPLAPPSFQPHFCCPFYFIFQRSMYFPSQPPPIEKKNKTRATNG
HRTVPLSHAPSPPPPLCPGESPAFLREFWGPPSLSYPPVLLWVLLTPFWISSYKSRVSSL
FAAQSPSFLSGRAPSSPPKREAQKHFSALAPPLSRFIAFALPSFPQSVLTATFWVNPQFK
IKLEEVDDQPDGHFGGHDSGCSILLALMQKHRRRERRYGRDMETIGFAVYDVPRELVGKP
SVHLKREFFLSHSSRARSEEFINLREVSSRLCLPPGEYIVVPSTFEPNKEGDFVLRFFSE
KKAGTEELDDKIEAHLPDERVLSEEEIDDTFKNLFKQLAGADMEISVKELQTILNKIVGK
HKDLRTDGFSKESCRSMVNLMDRDGNGKLGLVEFNILWNRIKNYLTIFRKYDVDKSGSMS
SYEMRMALEAAGEALTWSGSY
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagagatcatcacccctgtgtactgcacaggggtgtctgcccaagtgaagaag
cagcgggccaaagatttgggcctgggcagccatgagaacagcattaagtacttgggccag
gactatgaccagctccggtcccagtacctgcaggctggggtcctgttccaggacgagacc
tttcccccttctccccattccctgggcttcaaggaactggggcccaactcctccaaaatc
tatggcgttaagtggaaaaggcccacggaacttctttcaaacccccagtttatcgtcgat
ggggccacccgaactgacatttgtcagggagcactgggagactgctggcttctggcagcc
atcgcatccatcaccctgaatgagcccatcttgcaccgggtggtaccccatgggcagagc
ttccaggatggctatgctggcatctttcatttccagctgtggcagttcggggagtgggtc
gacgtggtcgtggacgacctgctgcccaccaaggacgggaagctggtcttcgtgcactcg
gcccaaggcaacgagttctggagcgccctgctggagaaagcctacgccaaggtgaatggc
agctacgaagccctgtcggggggcagcacatcggagggcttcgaagacttcacgggaggc
gtcaccgagtggttcaatctcaggaagcctcctcaggatctctaccagattattctgaag
gccctggagcgggggtccctgctgggctgctccatcgacgtgagtcttctacccctggct
ccgccctcctttcagccccacttttgttgtcccttttactttattttccaaagaagcatg
tattttccctctcaacctccccccattgagaagaaaaacaaaacccgggccacaaatggc
cataggacagttcccctgtctcatgccccctcccctccccctcccctctgtccaggggag
agccctgccttcctcagggaattctgggggccgcccagcctgtcataccctcccgtccta
ctctgggttctgctcacgccattttggatcagttcatacaagtcccgggtttcttccttg
tttgcagcccaatccccctcctttctcagtgggcgggcaccctcctctcccccaaaaaga
gaagcccagaagcactttagtgccttggctcctcctctttcccggtttatagcttttgct
ttgccctcattcccccaatctgttcttacagccaccttctgggtgaacccccagtttaag
atcaaactggaggaggtggacgaccaacccgacggccactttgggggccacgattctggt
tgcagcatcctgctggcgctcatgcagaaacatcgacggcgagagcgccgctacggccgg
gatatggagaccattggcttcgcggtctatgatgttcctcgggagttggtgggcaagcct
agtgtgcacctgaagcgggaattcttcctgtctcactcatcccgggcccgctcggaggag
ttcatcaacctgagggaggtcagctcccgcctgtgcttgcctcctggagagtacattgtg
gtgccctccacctttgagcccaacaaggaaggcgactttgtactccgcttcttctccgag
aagaaggctgggactgaggagctggatgacaagatcgaggctcaccttcctgatgagaga
gtgctctcggaagaggagattgatgataccttcaagaacctttttaagcagttggccggg
gcggacatggagatcagtgtcaaggaactgcagaccatcctgaataagattgttggcaaa
cacaaagacctccggactgatggctttagcaaggagtcatgccgaagcatggtgaatctc
atggatcgggatggcaatggaaaactggggctggtggagtttaacatcctttggaaccga
atcaaaaattatctgaccatcttccggaagtatgacgtagacaagtcgggcagcatgagc
tcctatgagatgcggatggctcttgaagcagcaggtgaagccctgacctggtcggggagc
tactag

DBGET integrated database retrieval system