KEGG   Monodelphis domestica (opossum): 100030435Help
Entry
100030435         CDS       T01031                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100030435 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100030435 (GYS1)
   04152 AMPK signaling pathway
    100030435 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100030435 (GYS1)
   04922 Glucagon signaling pathway
    100030435 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100030435 (GYS1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100030435 (GYS1)
Glycosyltransferases [BR:mdo01003]
 Polysaccharide
  Storage polysaccharide
   100030435 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 811 aa AA seqDB search
MPLSRSLSVSSLPGLEDWEDELDLDTLSSFLSWGPQGAGVANVRGLSLGPDPRRTPGCTY
PPLASVAHVTGGGQGHSLRIAPSPPPPQKGQQAAGRGRGCWPSRWAGGRAGRRGPVASRG
AMSKEGTGGLLLLEMTDRPSGELAGTTLGGKEAMPLRGEAGPWAPQPRVCTPQVYFGRWL
IEGGPPVVLLDVGAAAWALERWKGELWDTCSIGVPWYDREANDAVLFGFLTTWFLGEFWA
QSDEKPFIVGHFHEWLAGVGLCLCRARKLPVATIFTTHATLLGRYLCAGAVDFYNNLENF
NVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKF
SAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALA
RLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYES
LLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFN
SSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSI
STNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCTQLTSFLYSFCQQSRRQRIVQRN
RTERLSDLLDWKYLGRYYMFARHMALARAFPDHFTYEPHDADATQGFRYPRPASVPPSPS
LSRHSSPHQSEGEEEEEGEENGNRSSGFDEDSERYNEEEEAEKDRRNIRAPEWSRRASAS
KRGSVDTAPSSSPSTPSEPLSPASSLGEERN
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcagccgcagcctgtccgtgtcgtcgctgcccgggctggaggactgggaagat
gagctggacttggacacgctgtcctcttttctgagctggggcccacagggggccggggtg
gctaatgtgaggggcctcagccttgggcctgaccccaggagaaccccagggtgcacctac
ccacccctggcaagtgttgcccatgtgacaggaggagggcagggtcacagcctaagaata
gccccttcccccccacccccccagaaagggcagcaagcagctgggagggggaggggctgc
tggccttcccgctgggcggggggaagggcgggcagaagagggccagtagccagtaggggc
gccatgagcaaggagggaacaggagggcttctcctgcttgagatgactgacagacccagt
ggggagcttgctggaactaccctaggtgggaaggaagcgatgcccctgagaggggaggcg
gggccctgggcaccccagccacgtgtctgcaccccccaggtgtactttggccgctggctg
attgagggcggccccccagtggtgctgctggacgtgggggctgctgcctgggctctggag
cgctggaagggcgagctgtgggacacttgcagcattggggtcccctggtacgaccgcgaa
gccaatgacgctgtcctctttggctttctcaccacttggttcctgggagagttctgggct
cagagcgatgagaagcccttcattgtgggccatttccacgagtggctggccggtgtgggc
ctatgcctatgtcgggcccggaagctacccgtggccaccatcttcaccactcacgccacg
ctcttgggccgctacctgtgtgctggggccgtggatttctacaacaacctggagaatttc
aatgtggacaaggaggctggggagcggcagatctatcaccgctactgtatggagcgggcg
gctgcccactgcgcccacgtctttaccaccgtgtcccagatcacggccatcgaggctcag
cacctgctgaagaggaagccagatattgtcacccccaatgggctcaatgtgaagaagttc
tcggccatgcatgagttccagaacctgcacgcccagagcaaggctcgaatccaggagttt
gtgaggggccacttctatggccacctggacttcaacttggacaagaccctgtacttcttc
atcgccggccgctacgagttctccaacaagggtgcagatgtcttcctggaggccctggct
cgcctcaactacctgctcagggtgaatggcagcgagcagactgtggtggccttcttcatc
atgccggcacggaccaacaacttcaatgtggagaccctcaagggccaggccgtgcgcaag
cagctctgggacactgccaacactgtcaaggagaagtttgggagaaagctctacgagtcc
ctgctggttggcagcctcccagacatgaacaagatgctggacaaggaggacttcaccatg
atgaagagagccatctttgctacgcagcggcagtccttcccccctgtgtgtacccacaac
atgttggatgactcttcggaccccatcctcaccaccatccgacgcatcggcctcttcaat
agcagcgccgaccgcgtgaaggtgatcttccatcctgagttcctctcgtccaccagccct
ctgcttcccgtggattatgaagagtttgttcggggctgccacctcggggtcttcccctcc
tactacgagccctggggctacacgcctgccgaatgcaccgtcatgggcatccccagtatc
tccaccaacctctcgggcttcggctgtttcatggaggagcacatcgcggacccctctgcc
tatggcatctacatcctggaccggaggttccgaagcctggatgactcgtgcacccaactg
acctcgttcctctatagcttctgccagcagagccggagacaacggattgtccaacggaac
cgcacagaaaggctctcagacctgctggactggaaatacctgggccggtattacatgttt
gcccgccacatggccctggccagggccttcccggatcatttcacgtatgagcctcatgat
gctgatgctacgcagggcttccgttacccacgcccagcctcagtgcccccatcaccatcc
ctgtcccgccactccagcccccaccagagcgagggggaggaagaggaagaaggggaggag
aacgggaaccgaagctcaggcttcgatgaggacagtgagcgctacaacgaagaagaggag
gctgagaaggaccggaggaacattcgggcccctgagtggtcacggcgggcctcagcctcc
aaacggggttctgttgatacggccccctccagttctcccagcacccccagcgaacccctc
agccctgccagctctctaggggaggagcgcaactag

DBGET integrated database retrieval system