KEGG   Monodelphis domestica (opossum): 100030776Help
Entry
100030776         CDS       T01031                                 

Gene name
HADHA
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:mdo01200]
Metabolism; Overview; Fatty acid metabolism [PATH:mdo01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mdo00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mdo00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:mdo00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mdo00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mdo01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mdo00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mdo00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mdo00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mdo00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 763 aa AA seqDB search
MVASRAIGSLSRLTASRARRFTGYACRNFAQSPAVLTRTHVDYAIKGDVAVVRLNSPNSK
VNTLNKELTSDFVKVMNEIWTSDTVKSAVIISSKPGCFIAGADINMIAACKTAQEVTQLS
REGQQMLEKLEKSPKPIVAAISGSCLGGGLELAIACQYRIATKDKKTVLGTPEVLLGILP
GAGGTQRLPKMVGIPAAFDMMLTGRNIRADRAKRMGLVDQLVDPLGPGLKLPEDRTVEYL
EEIAIIFAKGLADKKISGKKEKGLIDMVTTYVMTIPFVRQQIYKKVEEKVQKQTKGLYPA
PLKIIDVVKTGIEHGNEAGYLSESQKFGELAMTKESKALVGLYHGQVLCKKNKFGTPQKA
VMQICVLGAGLMGAGIAQVSVDKGIKTILKDTSIAGLGRGQQQIFKGLDDKVKKKAITSF
ERDSIYSNMTGQLDYQGFEKADMVIEAVFEDIQLKHAVLKEVESVVPSHCIFASNTSALP
IGEIASVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTIASAVSVGLKQGKVIIVVK
DGPGFYTTRCLTPMMSEVIRILQEGVEPKKLDSLTTNMGFPVGAATLVDEVGVDVALHVS
TALTKAFGERFGGGNIELLRQMVNRGFLGRKSGKGFYIYQEGVKSRSLNSAMNEILSNMK
VSAPAEVCTPEEIQYRVLTRFVNEAVMCLQEGILASPEEGDIGAVFGLGFPPCLGGPFRF
SDLYGAHKLVDRMKKYEAVYGKQFTPCQLLIDHANNPSKKFYQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctcccgggcaattggcagcctcagccgcctgacggcttcccgcgcccgccgc
ttcacaggttatgcctgccgaaactttgctcagtccccagctgtgctaaccaggacccat
gttgactatgcaatcaaaggagatgtggcagttgtgcgacttaactcgcccaattcaaag
gtaaacactttgaataaagaattaacatcagattttgtaaaagtcatgaatgaaatatgg
actagtgatacagtcaaaagtgctgtcattatctcctcaaagccaggctgctttattgcg
ggtgctgatatcaacatgatagctgcttgcaagactgctcaagaagtaacacaattatca
agagaaggacaacaaatgttggagaaacttgagaagtctccaaaacctattgtggctgcc
atcagtgggtcctgcctgggaggaggacttgagcttgccattgcatgtcaatacagaata
gcaacaaaagacaaaaaaacagtattggggacccctgaagtattactgggaatattgcca
ggagcaggaggcactcaaaggctccccaaaatggttgggattcctgctgcctttgacatg
atgttgactggtagaaatattcgtgcagacagagcaaagagaatgggtctggttgaccaa
ttggtggatcctctaggaccaggtttgaaactaccagaagatcgaacagttgaatacctt
gaagaaatagcaatcatctttgcaaaaggactggctgataaaaagatctctgggaagaag
gaaaagggactgattgatatggtaacaacatacgtcatgactattccatttgtgaggcaa
cagatctacaaaaaagttgaagaaaaggtacagaaacaaaccaaaggtctttacccggct
cctctgaaaataattgatgtggtgaagactggaattgaacatggaaatgaggctggctac
ctctctgaatctcagaaatttggtgaacttgcaatgaccaaagaatctaaggctttagtt
ggtctctaccatggtcaggttctttgcaagaagaataagtttggaactccacagaaggct
gttatgcaaatatgtgttcttggagctggtcttatgggagctggcattgcccaagtctct
gtggataaagggataaagactatactcaaagatacttcaatagcagggttaggacgagga
cagcagcaaattttcaaaggattggatgataaagtgaagaagaaggccataacatcattt
gaaagggattccatttacagcaacatgactgggcagcttgattatcagggatttgaaaag
gctgacatggtaattgaagctgtttttgaagacatccagcttaagcatgcagttctgaag
gaagttgaatcagtggtgccctctcattgtatctttgctagtaacacatcagctctccca
attggtgaaattgcttctgttagcaaaagacctgaaaaggtcattggaatgcactacttt
tctcctgtggacaagatgcagctactagagatcattacaacagaaaaaacttccaaggac
acaattgcctctgcagtctcagttggtctcaagcaagggaaagtgatcattgtagttaag
gatggaccaggcttctataccaccaggtgccttacacccatgatgtctgaagtcatccga
attctgcaggaaggtgttgagcctaagaagttggatagcctgactacaaacatgggcttt
cctgtgggtgctgccacacttgtagatgaagttggtgttgatgtggctctgcatgtttca
acagcgctgaccaaagcctttggggaacgctttggaggtggaaacatagaactgctgaga
caaatggtcaacagaggtttcttgggtcgcaagtctggaaagggcttttacatctaccag
gaaggagtgaagagcaggagtttgaactctgccatgaatgaaattctgtcaaatatgaag
gtgtctgctccagccgaagtatgtaccccagaagagatccaataccgagtattgacaaga
tttgtgaatgaagcagtcatgtgcctacaagaaggtatcctggcttcccctgaagaggga
gacattggtgcagtctttggccttggcttccccccatgtcttggaggtcccttccgtttc
tcagatctgtatggtgctcataagttggtggaccggatgaagaaatatgaggcagtctat
ggaaaacagttcaccccttgccaactactaattgaccatgccaacaaccctagcaaaaag
ttttatcagtga

DBGET integrated database retrieval system