KEGG   Monodelphis domestica (opossum): 100030776Help
Entry
100030776         CDS       T01031                                 

Gene name
HADHA
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00062  Fatty acid elongation
mdo00071  Fatty acid degradation
mdo00280  Valine, leucine and isoleucine degradation
mdo00310  Lysine degradation
mdo00380  Tryptophan metabolism
mdo00410  beta-Alanine metabolism
mdo00640  Propanoate metabolism
mdo00650  Butanoate metabolism
mdo01040  Biosynthesis of unsaturated fatty acids
mdo01100  Metabolic pathways
mdo01200  Carbon metabolism
mdo01212  Fatty acid metabolism
Module
mdo_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
mdo_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mdo_M00085  Fatty acid biosynthesis, elongation, mitochondria
mdo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100030776 (HADHA)
   00650 Butanoate metabolism
    100030776 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    100030776 (HADHA)
   00071 Fatty acid degradation
    100030776 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    100030776 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100030776 (HADHA)
   00310 Lysine degradation
    100030776 (HADHA)
   00380 Tryptophan metabolism
    100030776 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100030776 (HADHA)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100030776 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100030776 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 100030776
NCBI-ProteinID: XP_001380198
Ensembl: ENSMODG00000015815
UniProt: F7FE46
Position
1
AA seq 763 aa AA seqDB search
MVASRAIGSLSRLTASRARRFTGYACRNFAQSPAVLTRTHVDYAIKGDVAVVRLNSPNSK
VNTLNKELTSDFVKVMNEIWTSDTVKSAVIISSKPGCFIAGADINMIAACKTAQEVTQLS
REGQQMLEKLEKSPKPIVAAISGSCLGGGLELAIACQYRIATKDKKTVLGTPEVLLGILP
GAGGTQRLPKMVGIPAAFDMMLTGRNIRADRAKRMGLVDQLVDPLGPGLKLPEDRTVEYL
EEIAIIFAKGLADKKISGKKEKGLIDMVTTYVMTIPFVRQQIYKKVEEKVQKQTKGLYPA
PLKIIDVVKTGIEHGNEAGYLSESQKFGELAMTKESKALVGLYHGQVLCKKNKFGTPQKA
VMQICVLGAGLMGAGIAQVSVDKGIKTILKDTSIAGLGRGQQQIFKGLDDKVKKKAITSF
ERDSIYSNMTGQLDYQGFEKADMVIEAVFEDIQLKHAVLKEVESVVPSHCIFASNTSALP
IGEIASVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTIASAVSVGLKQGKVIIVVK
DGPGFYTTRCLTPMMSEVIRILQEGVEPKKLDSLTTNMGFPVGAATLVDEVGVDVALHVS
TALTKAFGERFGGGNIELLRQMVNRGFLGRKSGKGFYIYQEGVKSRSLNSAMNEILSNMK
VSAPAEVCTPEEIQYRVLTRFVNEAVMCLQEGILASPEEGDIGAVFGLGFPPCLGGPFRF
SDLYGAHKLVDRMKKYEAVYGKQFTPCQLLIDHANNPSKKFYQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctcccgggcaattggcagcctcagccgcctgacggcttcccgcgcccgccgc
ttcacaggttatgcctgccgaaactttgctcagtccccagctgtgctaaccaggacccat
gttgactatgcaatcaaaggagatgtggcagttgtgcgacttaactcgcccaattcaaag
gtaaacactttgaataaagaattaacatcagattttgtaaaagtcatgaatgaaatatgg
actagtgatacagtcaaaagtgctgtcattatctcctcaaagccaggctgctttattgcg
ggtgctgatatcaacatgatagctgcttgcaagactgctcaagaagtaacacaattatca
agagaaggacaacaaatgttggagaaacttgagaagtctccaaaacctattgtggctgcc
atcagtgggtcctgcctgggaggaggacttgagcttgccattgcatgtcaatacagaata
gcaacaaaagacaaaaaaacagtattggggacccctgaagtattactgggaatattgcca
ggagcaggaggcactcaaaggctccccaaaatggttgggattcctgctgcctttgacatg
atgttgactggtagaaatattcgtgcagacagagcaaagagaatgggtctggttgaccaa
ttggtggatcctctaggaccaggtttgaaactaccagaagatcgaacagttgaatacctt
gaagaaatagcaatcatctttgcaaaaggactggctgataaaaagatctctgggaagaag
gaaaagggactgattgatatggtaacaacatacgtcatgactattccatttgtgaggcaa
cagatctacaaaaaagttgaagaaaaggtacagaaacaaaccaaaggtctttacccggct
cctctgaaaataattgatgtggtgaagactggaattgaacatggaaatgaggctggctac
ctctctgaatctcagaaatttggtgaacttgcaatgaccaaagaatctaaggctttagtt
ggtctctaccatggtcaggttctttgcaagaagaataagtttggaactccacagaaggct
gttatgcaaatatgtgttcttggagctggtcttatgggagctggcattgcccaagtctct
gtggataaagggataaagactatactcaaagatacttcaatagcagggttaggacgagga
cagcagcaaattttcaaaggattggatgataaagtgaagaagaaggccataacatcattt
gaaagggattccatttacagcaacatgactgggcagcttgattatcagggatttgaaaag
gctgacatggtaattgaagctgtttttgaagacatccagcttaagcatgcagttctgaag
gaagttgaatcagtggtgccctctcattgtatctttgctagtaacacatcagctctccca
attggtgaaattgcttctgttagcaaaagacctgaaaaggtcattggaatgcactacttt
tctcctgtggacaagatgcagctactagagatcattacaacagaaaaaacttccaaggac
acaattgcctctgcagtctcagttggtctcaagcaagggaaagtgatcattgtagttaag
gatggaccaggcttctataccaccaggtgccttacacccatgatgtctgaagtcatccga
attctgcaggaaggtgttgagcctaagaagttggatagcctgactacaaacatgggcttt
cctgtgggtgctgccacacttgtagatgaagttggtgttgatgtggctctgcatgtttca
acagcgctgaccaaagcctttggggaacgctttggaggtggaaacatagaactgctgaga
caaatggtcaacagaggtttcttgggtcgcaagtctggaaagggcttttacatctaccag
gaaggagtgaagagcaggagtttgaactctgccatgaatgaaattctgtcaaatatgaag
gtgtctgctccagccgaagtatgtaccccagaagagatccaataccgagtattgacaaga
tttgtgaatgaagcagtcatgtgcctacaagaaggtatcctggcttcccctgaagaggga
gacattggtgcagtctttggccttggcttccccccatgtcttggaggtcccttccgtttc
tcagatctgtatggtgctcataagttggtggaccggatgaagaaatatgaggcagtctat
ggaaaacagttcaccccttgccaactactaattgaccatgccaacaaccctagcaaaaag
ttttatcagtga

DBGET integrated database retrieval system