KEGG   Monodelphis domestica (opossum): 100030818Help
Entry
100030818         CDS       T01031                                 

Gene name
GAA
Definition
glucosidase, alpha; acid
Orthology
K12316  
lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mdo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mdo00500]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mdo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 954 aa AA seqDB search
MDMEGMPRSWRFNWLIFGGCSVAVLMIFALLGASFLHVSVVIPRESRDISAQQGIYRAEK
EATGKSWAQPHQEFHKNSTGTPLYCNISPDYRFDCAPEKTLTQEQCEARGCCYVPVTQQG
FSQIWTPWCFFPQSYPSYKLENLTTTKTGYTATLTRTVPTFFPKDILTLHLEVHMETESR
LHFTIKDPSNQRYEVPMETPKVNTRAPSPLYSVSFEANPFGLVIFRKSNGMVLLNTTIAP
LFFADQFLQITTSLPSHYITGLGEHQTSLILSTNWTKITFWNRDLPPVPGANLYGSHPFY
LCLEEGGLAHGVFLLNSNAMDVVLQPRPALTWRAIGGILDFYIFLGPEPKSVVQQYLEVI
GYPFMPPYWGLGFHLCRWGYSSTTITRQVVKNMTAANFPLDVQWNDLDYMDAKRDFTFNK
DNFSDFPAMVQEFHQSGRRYVMIVDPAISSTGPPGSYRPYDEGLRRGVFITNETGQPLIG
KVWPGETAFPDFTNPHTRDWWYDIVEEFHTQVPFDGMWIDMNEPSNFVTGSVEGCPNNEL
ENPPYVPGVIGGTLRAVTICASSQQYLSSHYNLHNLYGLTEAIASHDALVRIRGKRPFVI
SRSTFAGHGRYAGHWTGDVSSTWEQLYYSVPEVLLFNLYGVPLVGADICGFVGSTSEELC
VRWTQLGAFYPFMRNHNNKYNQPQEPYVFSEEAQQAMRRAFTLRYMFLPYLYTLFHKAHS
RGETVARPLFLEFPLDSNTWTLDRQFLWGEALLITPVLEVGKIDVNGYFPSGTWYPLMEV
PMEPLIDSSPSSPALQSSVIHSKGQWFTLPAPLEVINIHLRAGYILLLQDPGLTTTESRS
KPMTLIVALTPSGMAKGELFWDDGESLGTLEWGHYTQIMFLANNNVILNDLVQVTSEGTS
LKLRKVTVLGVTTNPKQVFSNGVPIFNFSYNADTQILDIPVSLSVAEQFLISWS
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggatatggaaggaatgccacgttcctggcgcttcaattggctgatttttggaggatgt
agtgttgctgtcttaatgatatttgctctcttgggggcttcctttctccatgtatcagtt
gtgattccaagagaatccagagacatctcagcacagcaaggcatctatagggctgaaaag
gaggcaacagggaagtcctgggcccagccccatcaggagtttcataaaaactccactgga
actcctttgtattgtaacatctcccctgattaccgctttgactgtgctccagaaaagacc
ctcactcaggagcagtgtgaagcccgaggctgctgctatgttccagtaactcagcaggga
ttctcccaaatatggacgccatggtgcttcttcccacaaagttacccaagctacaaattg
gagaacctcaccaccactaagacaggctacactgcaactctaactcgtacagtacctacc
ttcttccctaaggacatcctaaccctgcatttggaggtgcacatggagacagaaagccga
ctgcattttacaatcaaagatccttccaatcagcggtatgaggttcccatggaaacccct
aaagtcaataccagggctccttctcctctctacagtgtgtcatttgaggccaatcccttt
ggtttggtcatatttaggaagtcaaatggaatggtcttgttaaatacaaccattgctccc
ctgttctttgctgaccagtttctccagattactacctcccttccttcccactatattact
ggccttggggaacaccagacatccctaatactcagcaccaactggaccaagatcaccttc
tggaacagagacctaccacctgtgcctggggccaatctgtatggttcccaccctttctac
ctatgcctggaggaaggaggtttggcccatggggtcttcctactgaacagcaatgccatg
gatgtagtattacagccaagacctgccctgacctggagagcaataggaggcatactggat
ttctacatcttcctggggccagagccaaagagtgtggttcagcagtacttggaagttatt
ggatacccatttatgccaccttactggggtctgggcttccacctgtgccgatggggctac
tcctccaccaccatcactcgacaggtggtaaagaacatgacagcagctaactttcccctc
gatgtccagtggaatgacttagattacatggatgccaagagggactttactttcaacaag
gacaacttctcagattttccagccatggtacaggagtttcatcagagtggccggcgttac
gtcatgattgtggatccagccatcagcagcactggcccccctgggagctacagaccctac
gacgaaggtctgagaagaggagtattcatcaccaatgagacagggcaacctctgattggg
aaggtttggcctggggagacggctttccctgatttcaccaatccacatacccgggattgg
tggtatgacattgtggaggagttccacactcaagtaccctttgatggcatgtggattgac
atgaatgagccatctaactttgttacaggctctgtggaaggttgccccaacaatgagcta
gaaaatcctccctatgtgccaggtgtgattggaggtaccctgagggcagtaaccatttgt
gcctctagccagcaatacttgtcttcccactacaatctgcacaatttgtatgggctgact
gaagccattgcctcccatgatgccttggtgaggattcggggaaagcgtccctttgtgata
tctcgatctacctttgctggccatggccgttatgctggccactggacaggagatgtgtct
agtacctgggagcagttgtactactctgtgccagaggtgctactctttaacttgtatggg
gtacctttggtgggagcagacatctgtggctttgtaggaagtacttcagaggaactgtgt
gtgcgatggacccagctgggagccttctatcctttcatgcggaaccataataacaaatac
aaccagccccaggagccatatgtgttcagtgaagaggcgcagcaagctatgagaagagcc
tttactttgcgctacatgttcctcccctatctctataccctgttccacaaagcccattct
cgtggagagactgtggctcgacctctctttttggagtttcccttggacagtaacacctgg
acactggaccgtcagttcctttggggagaagctctccttattactccagtacttgaagtt
ggcaagatcgacgtgaatggctactttccctcaggcacatggtacccccttatggaggta
ccaatggagcctcttattgactcatcaccttcatctcctgctctccaaagctcggtcatc
cacagcaaaggacagtggttcaccctgcctgcaccactagaagtgatcaatattcacctt
cgggctggttacattcttctactgcaggatcctggattaaccaccacagagtcccgcagt
aaaccaatgaccttgattgtggccttaactccaagtggcatggccaagggggaactgttc
tgggatgatggagagtcccttgggacactggaatggggtcactatacccaaatcatgttc
ttggctaacaataatgttattctcaatgatctggtacaagtgactagtgagggcactagt
ctgaaactgagaaaagtgactgttctaggggtgaccaccaaccccaagcaggtcttctct
aatggtgtcccaatcttcaacttctcctacaacgctgacactcagatcctggacatccct
gtgtcattgtcagtggcagagcagtttcttatcagctggtcctaa

DBGET integrated database retrieval system