KEGG   Monodelphis domestica (opossum): 100030818Help
Entry
100030818         CDS       T01031                                 

Gene name
GAA
Definition
glucosidase, alpha; acid
Orthology
K12316  
lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100030818 (GAA)
   00500 Starch and sucrose metabolism
    100030818 (GAA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100030818 (GAA)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100030818 (GAA)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100030818 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 954 aa AA seqDB search
MDMEGMPRSWRFNWLIFGGCSVAVLMIFALLGASFLHVSVVIPRESRDISAQQGIYRAEK
EATGKSWAQPHQEFHKNSTGTPLYCNISPDYRFDCAPEKTLTQEQCEARGCCYVPVTQQG
FSQIWTPWCFFPQSYPSYKLENLTTTKTGYTATLTRTVPTFFPKDILTLHLEVHMETESR
LHFTIKDPSNQRYEVPMETPKVNTRAPSPLYSVSFEANPFGLVIFRKSNGMVLLNTTIAP
LFFADQFLQITTSLPSHYITGLGEHQTSLILSTNWTKITFWNRDLPPVPGANLYGSHPFY
LCLEEGGLAHGVFLLNSNAMDVVLQPRPALTWRAIGGILDFYIFLGPEPKSVVQQYLEVI
GYPFMPPYWGLGFHLCRWGYSSTTITRQVVKNMTAANFPLDVQWNDLDYMDAKRDFTFNK
DNFSDFPAMVQEFHQSGRRYVMIVDPAISSTGPPGSYRPYDEGLRRGVFITNETGQPLIG
KVWPGETAFPDFTNPHTRDWWYDIVEEFHTQVPFDGMWIDMNEPSNFVTGSVEGCPNNEL
ENPPYVPGVIGGTLRAVTICASSQQYLSSHYNLHNLYGLTEAIASHDALVRIRGKRPFVI
SRSTFAGHGRYAGHWTGDVSSTWEQLYYSVPEVLLFNLYGVPLVGADICGFVGSTSEELC
VRWTQLGAFYPFMRNHNNKYNQPQEPYVFSEEAQQAMRRAFTLRYMFLPYLYTLFHKAHS
RGETVARPLFLEFPLDSNTWTLDRQFLWGEALLITPVLEVGKIDVNGYFPSGTWYPLMEV
PMEPLIDSSPSSPALQSSVIHSKGQWFTLPAPLEVINIHLRAGYILLLQDPGLTTTESRS
KPMTLIVALTPSGMAKGELFWDDGESLGTLEWGHYTQIMFLANNNVILNDLVQVTSEGTS
LKLRKVTVLGVTTNPKQVFSNGVPIFNFSYNADTQILDIPVSLSVAEQFLISWS
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggatatggaaggaatgccacgttcctggcgcttcaattggctgatttttggaggatgt
agtgttgctgtcttaatgatatttgctctcttgggggcttcctttctccatgtatcagtt
gtgattccaagagaatccagagacatctcagcacagcaaggcatctatagggctgaaaag
gaggcaacagggaagtcctgggcccagccccatcaggagtttcataaaaactccactgga
actcctttgtattgtaacatctcccctgattaccgctttgactgtgctccagaaaagacc
ctcactcaggagcagtgtgaagcccgaggctgctgctatgttccagtaactcagcaggga
ttctcccaaatatggacgccatggtgcttcttcccacaaagttacccaagctacaaattg
gagaacctcaccaccactaagacaggctacactgcaactctaactcgtacagtacctacc
ttcttccctaaggacatcctaaccctgcatttggaggtgcacatggagacagaaagccga
ctgcattttacaatcaaagatccttccaatcagcggtatgaggttcccatggaaacccct
aaagtcaataccagggctccttctcctctctacagtgtgtcatttgaggccaatcccttt
ggtttggtcatatttaggaagtcaaatggaatggtcttgttaaatacaaccattgctccc
ctgttctttgctgaccagtttctccagattactacctcccttccttcccactatattact
ggccttggggaacaccagacatccctaatactcagcaccaactggaccaagatcaccttc
tggaacagagacctaccacctgtgcctggggccaatctgtatggttcccaccctttctac
ctatgcctggaggaaggaggtttggcccatggggtcttcctactgaacagcaatgccatg
gatgtagtattacagccaagacctgccctgacctggagagcaataggaggcatactggat
ttctacatcttcctggggccagagccaaagagtgtggttcagcagtacttggaagttatt
ggatacccatttatgccaccttactggggtctgggcttccacctgtgccgatggggctac
tcctccaccaccatcactcgacaggtggtaaagaacatgacagcagctaactttcccctc
gatgtccagtggaatgacttagattacatggatgccaagagggactttactttcaacaag
gacaacttctcagattttccagccatggtacaggagtttcatcagagtggccggcgttac
gtcatgattgtggatccagccatcagcagcactggcccccctgggagctacagaccctac
gacgaaggtctgagaagaggagtattcatcaccaatgagacagggcaacctctgattggg
aaggtttggcctggggagacggctttccctgatttcaccaatccacatacccgggattgg
tggtatgacattgtggaggagttccacactcaagtaccctttgatggcatgtggattgac
atgaatgagccatctaactttgttacaggctctgtggaaggttgccccaacaatgagcta
gaaaatcctccctatgtgccaggtgtgattggaggtaccctgagggcagtaaccatttgt
gcctctagccagcaatacttgtcttcccactacaatctgcacaatttgtatgggctgact
gaagccattgcctcccatgatgccttggtgaggattcggggaaagcgtccctttgtgata
tctcgatctacctttgctggccatggccgttatgctggccactggacaggagatgtgtct
agtacctgggagcagttgtactactctgtgccagaggtgctactctttaacttgtatggg
gtacctttggtgggagcagacatctgtggctttgtaggaagtacttcagaggaactgtgt
gtgcgatggacccagctgggagccttctatcctttcatgcggaaccataataacaaatac
aaccagccccaggagccatatgtgttcagtgaagaggcgcagcaagctatgagaagagcc
tttactttgcgctacatgttcctcccctatctctataccctgttccacaaagcccattct
cgtggagagactgtggctcgacctctctttttggagtttcccttggacagtaacacctgg
acactggaccgtcagttcctttggggagaagctctccttattactccagtacttgaagtt
ggcaagatcgacgtgaatggctactttccctcaggcacatggtacccccttatggaggta
ccaatggagcctcttattgactcatcaccttcatctcctgctctccaaagctcggtcatc
cacagcaaaggacagtggttcaccctgcctgcaccactagaagtgatcaatattcacctt
cgggctggttacattcttctactgcaggatcctggattaaccaccacagagtcccgcagt
aaaccaatgaccttgattgtggccttaactccaagtggcatggccaagggggaactgttc
tgggatgatggagagtcccttgggacactggaatggggtcactatacccaaatcatgttc
ttggctaacaataatgttattctcaatgatctggtacaagtgactagtgagggcactagt
ctgaaactgagaaaagtgactgttctaggggtgaccaccaaccccaagcaggtcttctct
aatggtgtcccaatcttcaacttctcctacaacgctgacactcagatcctggacatccct
gtgtcattgtcagtggcagagcagtttcttatcagctggtcctaa

DBGET integrated database retrieval system