KEGG   Monodelphis domestica (opossum): 100030869Help
Entry
100030869         CDS       T01031                                 

Gene name
GRIK4
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100030869 (GRIK4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100030869 (GRIK4)
Ion channels [BR:mdo04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100030869 (GRIK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 956 aa AA seqDB search
MPRVLAPLVLLLVWLMTVASSPHALRIAAILDDPMECNRGERLSITLAKNRINRAPERVG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVKLQSQRFTTLNLHPSNTDISVAVAGILRFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDSRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLLDDRVNILGFSIFNQSHAFFQEFVQSLNQSWQENCDHVPFTG
PALSSALLFDAVYTVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTKNGFRQIGQWHVSEGLSMDNRLSSSNISDSLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELSEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVTELRSIILCQDNFHPRRRRAGVTRPRPPIPEERRPRGTATLSNGKLCGAGEPDP
IAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgccccgggtcttggcgcctctggtgctccttctggtatggctcatgacagtcgccagc
agccctcatgctctgaggattgctgcaatcctggacgacccgatggagtgcaatcgaggg
gagaggttgtccatcacgctggccaagaaccggatcaatcgggctcctgagagggtaggg
aaggccaaggtggaggtggacatcttcgagctgctgagagatagcgagtacgagacagcg
gaaaccatgtgccagatactcccaaagggagtagtagccgtcttgggaccttcttctagc
cctgcctccagctccatcatcagcaacatctgtggggagaaggaggtgccccatttcaaa
gtggcccctgaagaatttgtgaagttgcagtcccagagattcaccaccctgaacctccac
cccagcaacacggacatcagtgtggcagtcgctgggatcctgaggtttttcaactgcacc
acagcctgcctcatctgcgccaaagcagaatgccttttaaacctggagaagctgctcaga
caattccttatctccaaggacacgctctccgtcaggatgctggatgacagccgggatcct
accccactcctcaaggagatccgggatgacaagacagccaccatcatcatccatgccaat
gcctccatgtcccacaccatcctcctgaaggcagctgaactggggatggtatcagcctat
tacacatatatcttcactaatctggagttctctctccagagaatggacagccttctggat
gaccgagtcaacatcctgggattttctattttcaaccaatcccatgctttcttccaagag
tttgtacagagtctcaaccagtcatggcaggagaattgtgaccacgtgcccttcactggg
cctgcactctcctcagccctgctatttgatgctgtctacactgttgtgactgcagtgcaa
gagttgaaccgaagtcaggagattggtgtgaagcctctatcttgtggctcagcacagatc
tggcagcatggtaccagcctcatgaactacctgagaatggtagaattggaaggtctcacc
ggccacattgaattcaacagcaaaggacagaggtccaactatgccctgaaaatattgcag
ttcacaaagaatggcttccggcagattggtcagtggcatgtgtccgagggtctcagcatg
gacaaccgtctctcctcttccaacatctccgacagcctcttcaacaccaccctggtcgtc
accaccatcctggagaacccgtacttaatgctgaaggggaaccaccaagagatggaaggc
aatgaccgctacgaaggcttctgcgtggacatgcttaaggaactctcggagattctacgc
ttcaactataagattcgcctggttggggatggagtatatggtgtgcctgaggccaacggc
acttggacaggaatggtcggggagctgattgctcggaaagcagatctggctgttgctgga
ctcactataacagctgaaagagagaaggtgatcgatttctccaagccgttcatgactctg
ggaattagtattctttacagggttcatatgggtcgaaaacctggttatttctccttcctg
gaccccttttctcctggagtctggctcttcatgcttcttgcctatctggctgtcagctgt
gtgctcttcctagtggctcggctaacgccctatgaatggtatagccctcatccttgtgcc
cagggccggtgtaaccttctggtgaatcagtactccctaggaaacagcttatggtttccc
gttgggggcttcatgcagcaaggctctacaattgcgccacgcgccttatccacccgatgt
gtcagcggagtctggtgggctttcactctgatcatcatctcatcttacacggccaacctg
gcagcattcctgaccgtacaacggatggatgtgcccatcgagtctgtggatgacttggct
gaccagacagccattgagtatggcacaattcatggaggatccagcatgacctttttccaa
aattcccgctaccaaacatatcagcggatgtggaattacatgtattctaagcagcctagt
gtgtttgtaaaaagcacggaagaagggattgcccgggtgctgaattccaactatgccttc
ttgctggagtccaccatgaatgaatactaccgccagcgaaactgcaatctcactcagatt
gggggcctgcttgacaccaagggctacgggatagggatgccagttggctctgtattccgt
gatgagtttgatctggccattctccaactacaagagaacaaccgcctggaaattttaaaa
agaaaatggtgggaaggggggaagtgccccaaagaagaagatcatagagctaaaggcctg
ggaatggagaatattggtggaatctttgttgttcttatctgtggcttaattgtggccatt
tttatggctatgttggagtttttatggacactccgacactcagaagcaactgaggtgtct
gtctgccaggagatggtgacagagttgcgcagcatcatcctgtgtcaggacaattttcac
ccgcgacggaggcgagctggggtgacccgtccccgcccccccatcccagaggagcgccga
cccaggggcaccgccacacttagcaatggcaagctttgcggggctggggagcccgatccc
attgcccagagactggcccaggaagctgctttggtggcccgtggttgtacacatatccgg
gtctgtccagagtgtcggaggttccagggcctaagagcacggccatccccagcccggagc
gaggagagcctggaatgggagaagactaccaacagcagtgagccggagtag

DBGET integrated database retrieval system