KEGG   Monodelphis domestica (opossum): 100030960Help
Entry
100030960         CDS       T01031                                 

Gene name
BAP1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100030960 (BAP1)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100030960 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 728 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDETSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YESKLHVLKMNRQTVLEALQQLIRVTQPELIQTQKSQESQPPEDSKPASCKPSLVLETSK
TPLASEASQTDGPEEVAGPCQPAPTHSPPSKPKLMVKPPVSSLNGVPTNPSPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYDEEEEEDVRNTNSAIRYKR
KGQVKQEPLPASSDGQLCVLQPNTINVLAEKLKESQKDLSIPLSIKTSGGAGSPAVAAPS
HSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDGLLR
VDCMRYNRAVRDLGPVISTGLLHLSEDGVLCPLTITEGGKGSSPPIRQSQATQISVTIEE
KEVPESSDREKAGLSRPPEQLCGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFK
IDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRS
RPYKAKRQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggctggttagagctggagagtgacccaggcctttttaccctgttggtagaa
gattttggtgttaaaggggtacaagttgaagagatttatgatcttcagagcaaatgccag
ggtccagtatatggtttcatcttcctcttcaaatggatcgaagaacgcaggtcccggcgc
aaggtctctacccttgtggacgagacttctgtgatcgatgatgacattgtgaataacatg
ttcttcgcccatcagctgattcccaactcctgtgccactcatgccttattgagtgtcctt
ctgaactgtagcaatgtggacttgggcccaacactgagccgcatgaaggatttcaccaag
ggttttagcccagagagcaagggatatgccattgggaatgctccagagctggccaaagca
cacaacagccatgccagacccgagccacgacacctgccagagaagcagaatgggatcagt
gctgttagaacaatggaggcattccactttgtcagctatgtccccatcaagggacgtctt
tttgagctagacgggctgaaagtgtatcccatcgaccatgggccctggggggaagatgaa
gagtggacagataaagcccgccgagtcatcatggaacgaattggcctagccacagcaggg
gagccatatcatgacatccgatttaacctgatggcggtagtgcccgaccgcaggatcaag
tatgaatctaagctgcatgtcctgaagatgaaccgacagacagtgttggaggccttacag
cagctgatccgagtgactcagccagaactgattcaaacccagaagtcccaagagtctcag
ccccctgaggactccaaaccagcctcctgcaagccctctctggtgcttgaaacaagcaag
accccactggcctctgaggcttctcaaacagatggacctgaagaggtggcagggccttgc
cagccagcccccacacatagcccacccagcaaacccaaactcatggtgaagcctccagtc
agcagcctcaatggggtcccaacaaaccccagtcccatcgttcagcggctcccagctttc
ttggataaccacaattatgctaagtctcctatgcaagaagaagaggacctggcagcaggt
gtaggccgcagccgtgtcccagttcgcccaccacagcagtactcagatgatgaagatgac
tatgatgaggaggaagaggaagatgttcggaacacaaattctgccatcaggtacaagcga
aaagggcaagttaagcaggagcccttgcctgcctcttctgatggtcagctctgcgtcctg
cagcccaacaccattaatgtgctagctgagaagcttaaggaatcccagaaagacctctca
attcctctatccatcaagactagtggcggtgctggaagcccagctgtagctgcgccctct
cattctcagccttcacccacccccagcaatgagagcaccgacacagcttctgaaattggg
agcgccttcaactctccacttcggtcccccatccgctctgccaatcctacccgcccgtcc
agccctgtcacctcccacatctccaaggtgctttttggggaggacgatgggttgttgcga
gtggactgcatgcgctacaaccgggctgtacgagacttggggcctgtcatcagcacaggt
cttctgcatctgtctgaggatggggtgctgtgtcctctcaccatcacagaaggtgggaaa
ggctcctcaccgcctatcagacagagccaggccacccagatcagtgtcaccatagaggag
aaggaggtacctgaatcaagtgaccgagagaaagctgggctgagccggccccctgaacag
ctgtgtggggaaaagtattcccccaaagaacttctggcactgttgaagtgtgtggaagca
gagatcgcaaactatgaagcctgtctcaaggaggaagtggaaaagaggaaaaagtttaag
attgatgatcagagaagaacccacaattacgatgagttcatctgcacatttatttccatg
ctggctcaggaaggcatgctggccaaccttgtggagcagaacatctctgtccggcgacga
cagggggtcagcatcggccggcttcataaacagagaaagcccgacaggcggaaacgctct
cgtccttacaaggccaaacggcagtga

DBGET integrated database retrieval system