KEGG   Monodelphis domestica (opossum): 100030975Help
Entry
100030975         CDS       T01031                                 

Gene name
KCNMB1
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 1
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100030975 (KCNMB1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100030975 (KCNMB1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100030975 (KCNMB1)
Ion channels [BR:mdo04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100030975 (KCNMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 203 aa AA seqDB search
MGKNLVTAQIRGETRALCLGTVMVVCSAIAYYILGTTMLPLFHKSVWTEVSDCHLVEADI
RDHEKLDGKKVPQYPCLLVNVSTIGKLTILYHTEETKEKNSQCSYIPERLEDYQEARMKV
EDVKVRFKEHQTFPCYSDPEESEKSVLLKKLYTPETLLKWLFWPTFMLTGGIFIIMMVKI
NQSLSILATQRKNPINTSQFRHN
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaatctggtgacagcacagatacgaggagagactcgtgccctgtgcctgggc
acagtcatggtggtgtgttctgccatcgcctactacatcctgggaacaaccatgctgccc
ttattccacaagagtgtatggactgaagtatctgattgtcacctagttgaagcagatatt
agggaccatgagaagctggatggcaagaaggtcccacagtatccatgtctgttggtcaat
gtatctaccattgggaagctgaccattttgtaccacacagaggagacaaaagaaaaaaat
tcccagtgttcctatatccctgagaggttggaagactaccaagaagccaggatgaaagtg
gaagatgtcaaggtcaggttcaaagagcaccagacttttccctgctactcagaccctgaa
gagagtgagaagagtgtcctgctcaaaaagctttatactccagagaccctgttgaagtgg
cttttttggcctaccttcatgctaactggaggaatattcatcataatgatggtgaaaatc
aaccagtctctctccatccttgcaacacagagaaagaacccgatcaatacttcacagttc
aggcacaactga

DBGET integrated database retrieval system