KEGG   Monodelphis domestica (opossum): 100031015Help
Entry
100031015         CDS       T01031                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100031015 (ARG1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    100031015 (ARG1)
   00330 Arginine and proline metabolism
    100031015 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100031015 (ARG1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100031015 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 317 aa AA seqDB search
MSSKPKSIGIIGAPFSKGQPRGGVEEGPAALRTAGIVERLEERECDVKDYGNLTFVDVPN
DTPFQIVKNPRTVGKANEQLAGAVAEVKKNGRTSLVLGGDHSLAIGSISGHAKVHPDLCV
IWVDAHSDINTPLTTTSGNLHGQPVSFLMKELKGKIPDVPGLSWVTPCLSAKDIVYIGLR
DVDPGEHQILKDLGIKYFSMTEVDKLGIGKVMEETLSYLIGRKKRPIHLSYDVDGLDPSV
TPATGTPVPGGLTLREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVNRTVNTAIAIT
LSCFGVAREGNHSAKRL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaagccaaagtcaattgggatcatcggagctcccttctccaaagggcagcca
cgaggaggagtagaagaaggtcctgcagcactgagaacagctggtatagttgaaagactt
gaagaacgagagtgtgatgtgaaagattatgggaacttgacctttgttgatgtgcccaat
gataccccctttcaaattgtgaagaatccaaggaccgtgggcaaggctaatgagcagcta
gctggagcagtagcagaagtgaagaagaatgggagaaccagcttggtacttggcggggat
cacagtttggcgattggaagtatctctggccatgccaaggttcaccctgatctctgcgtc
atttgggtagatgcacatagtgatatcaacactcctctgacaactacatctggcaactta
catggacagcctgtttctttccttatgaaggaactaaagggaaagatccctgatgttcca
ggattatcatgggtgacaccttgcttatcagccaaggacattgtatatattggattgaga
gatgtggatcctggtgaacatcaaattcttaaggatctgggcattaaatatttttcaatg
actgaagtggataagcttggaattggcaaagtgatggaggaaacactaagttacttaata
ggaaggaagaaaagaccaattcatctgagttatgatgtggatgggttggacccatctgtg
acaccagctactggcacacctgtccctggaggcctgactctcagagaaggtctctatatt
acagaagaaatctataagacagggctcctctcaggattagacataatggaagtcaatcca
tcccttggaaagacaccagaagaagtcaaccggacagtgaatactgctattgcgataact
ttatcctgttttggagtagctcgagagggcaatcatagtgccaagagactgtaa

DBGET integrated database retrieval system