KEGG   Monodelphis domestica (opossum): 100031097Help
Entry
100031097         CDS       T01031                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100031097
  Amino acid metabolism
   00350 Tyrosine metabolism
    100031097
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    100031097
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     100031097
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100031097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 357 aa AA seqDB search
MSWVGDPRHLVMLEGLVLGTIFATIILFLVLFLAWRFRAVLIFFWHEKILVSFVNFLSGM
SKEERILSWVKEHAMAGNPQSVLDAIDYYCYNTEWAMNVGDIKGVIMDRIVEEAKPRVLL
ELGTYCGYSAIRMARLLPPGARLFTIEFNESFASIASQMIQLAGLQDKISILKGSTQEII
PQLKKKHEISTVDLVFLDHWKDRYLPDTQLLLESGLLRKGSVLLADNVICPGAPEFLQFV
RGHPRFQCTHYPATVEYLRMRDALEKAVFLGXGPARGGGGNPWGPGLLFCFLPVKMTSFS
PEGSCPLCPESVQPCSPSRALRERPGMEEAPRPSLHPLSLHPGGWPRLPLRDFVPVR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgggtgggagatccccgtcatcttgtgatgctagagggcctcgtgttgggaacc
atatttgctaccatcatcctgttcctcgtgctcttcctggcctggcggttcagggccgta
ttgatctttttctggcatgaaaaaatcctggtcagcttcgtcaacttcctctcgggcatg
agcaaggaagagaggatcctatcctgggtgaaggagcacgccatggcgggcaacccccag
agtgtgctggatgccattgactactactgctacaataccgagtgggccatgaacgtgggg
gacatcaaaggtgtgatcatggacaggatcgtggaggaggccaagcccagggtcctgctg
gagctgggcacgtactgcggctactcggccatccggatggcccgcctgctgccccccggc
gcccgcctcttcaccatcgagttcaacgagagcttcgcctccatcgccagccagatgatc
cagctggccggcctgcaagacaagatttctatcctgaaagggtcgacccaagaaatcatc
ccgcagctgaagaagaagcacgagatcagcaccgtcgacctggtcttcctggaccactgg
aaggaccgctacctgcccgacacccagctgctcctggagagcggcctcctccggaagggc
tccgtgctgctggccgacaacgtcatctgcccgggggcccccgaattcctgcagttcgtg
cgcggccacccgcgcttccagtgcacccactacccggccaccgtggagtacctgcgcatg
agggacgccctcgagaaggccgtgttcctgggctgagggccggcgcgtggcgggggtggg
aacccctggggccccgggctcctcttctgttttcttccagtaaaaatgacgtccttctcc
cctgaagggagctgtcctttgtgtccggagtccgtgcagccgtgcagcccgagccgggcc
ctccgggagaggcctgggatggaggaggccccaaggcccagcctccatcccttgagcctc
caccctggaggctggcccaggctccccctcagggactttgtgccggtcaggtag

DBGET integrated database retrieval system