KEGG   Monodelphis domestica (opossum): 100031193Help
Entry
100031193         CDS       T01031                                 

Gene name
KAT2B
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100031193 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100031193 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100031193 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    100031193 (KAT2B)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100031193 (KAT2B)
Transcription machinery [BR:mdo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100031193 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 862 aa AA seqDB search
MSETGGAGPAGGGGGGGSGGAGGQPQQQPPPPPPQPPPVPLPPPLPLPPQGSPAAGGGPA
RAAASAAAASSPAPVPAGAGPGASSGPAAAAAESPGVGSGASTARIAVKKAQLRSAPRAK
KLEKLGVYSSCKAEESCKCNGWKNPNPPPTPPRADLQQIIVNLTESCRSCSHALAAHVSH
LENVAEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGS
LESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRQRS
PNDDVAGYKVNYTRWLCYCHVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQE
KDKLPLEKRTLILTHFPKFLSMLEEEVYSQSSPIWDPDFLTASSRASQLGIQTVINPPPV
ARTVSYNGSPSSLEQPIGGSMSPVCKVSSGLEGNRGEKRKMNDLHSLEEAKRPRVVGDIP
LELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKK
ILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTE
IVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSILNFLTYADEYAIGYFKKQGFSKDIKVPK
TKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC
FKDGVRQIPIESIPGIRETGWKPSGKERGKEPKDPDQLYSTLKNILQQVKSHQSAWPFME
PVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYY
KCANILEKFFFTKIKEAGLIDK
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagactggcggggccgggccggccgggggcggtggcggtggtggcagcggcggg
gccggggggcagccgcagcagcagccgccgccccctcccccgcagccgccgcctgtgcct
ctgcctcctcctctgccgctgcccccgcagggttccccggccgctgggggcggaccggcc
cgggccgcggcatccgcggccgctgcttcttctcctgcccccgtcccggccggcgccggc
cccggcgcctcctccgggccggccgccgccgccgccgagagccctggggtcggcagcggc
gcttctacggcccggatcgcggtgaagaaggcgcaactccgatccgctccgcgggccaag
aaactggagaaactcggcgtctactcctcttgcaaggccgaggaatcttgtaaatgtaat
ggctggaaaaaccccaaccccccgcccactcctccccgggcagacctgcaacagatcatt
gtcaatctcaccgagtcctgccgtagttgtagccacgctctcgctgctcacgtgtctcac
ctggagaatgtggcggaggaagaaatgaatagactgctgggcattgtattggatgtggag
tatctctttacttgtgttcacaaagaagaagatgcagacaccaaacaagtttatttctac
ctgttcaagctcttgagaaaatgcattttacaaatggggaaacctgtcgttgaaggatcc
ttggagagccctccgtttgagaagcctagtattgaacagggtgtgaataattttgtccag
tacaagtttagtcacctcccctccaaagagaggcagacaatcgttgagctggccaagatg
ttcctaaaccgcatcaactattggcacctggagacgccgtctcaacgaagacaacgctcc
ccaaacgatgatgtcgcaggatacaaggtgaactataccaggtggctgtgctattgccac
gtgcctcagttctgtgacagcctccctcggtatgagactacccaggtgtttgggagaacg
ctgctccgctccgtcttcaccgtgatgcgccgacagctcctggaacaagcccggcaggag
aaggacaagctgcccctggagaagcggacgctcatcctcacccatttcccaaagtttctc
tccatgttagaagaagaagtttatagccagagctcacctatctgggatcctgactttctg
actgcttcttctcgtgctagtcagctaggaatccaaacagtcatcaaccctcctcccgtg
gccaggactgtatcatacaatgggagcccgtcctctctggagcagccaattggaggaagc
atgagtcctgtttgcaaggtctcttctggactcgaaggaaaccgaggagagaagcgaaaa
atgaatgaccttcattctctggaggaagccaagagacccagagttgtgggggatattccc
cttgagttgatcaacgaggtcatgtccaccattacagaccctgctgcaatgctgggaccg
gagaccaattttctgtcagcacattcagcccgggacgaagcagccagattggaagaacgc
cgaggagtgatagaattccacgtagtcggcaactctctgaatcagaagccaaacaaaaag
atcctgatgtggctggtcggcttacagaatgtgttctctcatcagctccctagaatgccc
aaagagtatattacgcgcctggtctttgaccctaagcacaagacccttgctttaattaaa
gatggccgtgtgatcggtgggatctgtttccgtatgtttccgtcgcaaggattcacagag
attgtcttctgtgctgtaacttccaatgagcaagtcaagggctatggaactcacctcatg
aatcacctgaaagaataccatataaaacatagcatcctgaactttcttacgtatgctgat
gaatatgcaattggatacttcaagaaacaaggtttctccaaagatatcaaagtacccaaa
accaaatatgtaggctatatcaaggattatgaaggagccactctgatgggctgtgagcta
aacccaaggatcccatacacagaattttctgtcatcatcaaaaaacagaaggagatcatc
aagaaacttatagaaaggaagcaagcccagattcgaaaggtctaccccggactttcgtgt
tttaaagatggagtccgccagattccaatcgaaagcattcctggcatcagggagacaggc
tggaaaccaagtggaaaagaaagaggcaaagagcccaaagatcccgatcagctttatagt
acattaaaaaacatcctgcagcaggtgaagagccatcaaagcgcttggcccttcatggaa
cccgtgaagagaacggaagctcctggatattatgaagttataaggttccctatggatctg
aaaaccatgagtgaacgactcaagaacaggtactatgtatctaagaaattattcatggcc
gacttacagcgggtgtttaccaattgcaaagagtacaacccccctgagagcgaatactac
aaatgtgccaatatcctggagaaattcttcttcaccaaaattaaggaagctggattaatt
gacaagtga

DBGET integrated database retrieval system