KEGG   Monodelphis domestica (opossum): 100031193Help
Entry
100031193         CDS       T01031                                 

Definition
histone acetyltransferase KAT2B-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:mdo04330]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mdo04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mdo05203]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mdo05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 862 aa AA seqDB search
MSETGGAGPAGGGGGGGSGGAGGQPQQQPPPPPPQPPPVPLPPPLPLPPQGSPAAGGGPA
RAAASAAAASSPAPVPAGAGPGASSGPAAAAAESPGVGSGASTARIAVKKAQLRSAPRAK
KLEKLGVYSSCKAEESCKCNGWKNPNPPPTPPRADLQQIIVNLTESCRSCSHALAAHVSH
LENVAEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGS
LESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRQRS
PNDDVAGYKVNYTRWLCYCHVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQE
KDKLPLEKRTLILTHFPKFLSMLEEEVYSQSSPIWDPDFLTASSRASQLGIQTVINPPPV
ARTVSYNGSPSSLEQPIGGSMSPVCKVSSGLEGNRGEKRKMNDLHSLEEAKRPRVVGDIP
LELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKK
ILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTE
IVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSILNFLTYADEYAIGYFKKQGFSKDIKVPK
TKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC
FKDGVRQIPIESIPGIRETGWKPSGKERGKEPKDPDQLYSTLKNILQQVKSHQSAWPFME
PVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYY
KCANILEKFFFTKIKEAGLIDK
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagactggcggggccgggccggccgggggcggtggcggtggtggcagcggcggg
gccggggggcagccgcagcagcagccgccgccccctcccccgcagccgccgcctgtgcct
ctgcctcctcctctgccgctgcccccgcagggttccccggccgctgggggcggaccggcc
cgggccgcggcatccgcggccgctgcttcttctcctgcccccgtcccggccggcgccggc
cccggcgcctcctccgggccggccgccgccgccgccgagagccctggggtcggcagcggc
gcttctacggcccggatcgcggtgaagaaggcgcaactccgatccgctccgcgggccaag
aaactggagaaactcggcgtctactcctcttgcaaggccgaggaatcttgtaaatgtaat
ggctggaaaaaccccaaccccccgcccactcctccccgggcagacctgcaacagatcatt
gtcaatctcaccgagtcctgccgtagttgtagccacgctctcgctgctcacgtgtctcac
ctggagaatgtggcggaggaagaaatgaatagactgctgggcattgtattggatgtggag
tatctctttacttgtgttcacaaagaagaagatgcagacaccaaacaagtttatttctac
ctgttcaagctcttgagaaaatgcattttacaaatggggaaacctgtcgttgaaggatcc
ttggagagccctccgtttgagaagcctagtattgaacagggtgtgaataattttgtccag
tacaagtttagtcacctcccctccaaagagaggcagacaatcgttgagctggccaagatg
ttcctaaaccgcatcaactattggcacctggagacgccgtctcaacgaagacaacgctcc
ccaaacgatgatgtcgcaggatacaaggtgaactataccaggtggctgtgctattgccac
gtgcctcagttctgtgacagcctccctcggtatgagactacccaggtgtttgggagaacg
ctgctccgctccgtcttcaccgtgatgcgccgacagctcctggaacaagcccggcaggag
aaggacaagctgcccctggagaagcggacgctcatcctcacccatttcccaaagtttctc
tccatgttagaagaagaagtttatagccagagctcacctatctgggatcctgactttctg
actgcttcttctcgtgctagtcagctaggaatccaaacagtcatcaaccctcctcccgtg
gccaggactgtatcatacaatgggagcccgtcctctctggagcagccaattggaggaagc
atgagtcctgtttgcaaggtctcttctggactcgaaggaaaccgaggagagaagcgaaaa
atgaatgaccttcattctctggaggaagccaagagacccagagttgtgggggatattccc
cttgagttgatcaacgaggtcatgtccaccattacagaccctgctgcaatgctgggaccg
gagaccaattttctgtcagcacattcagcccgggacgaagcagccagattggaagaacgc
cgaggagtgatagaattccacgtagtcggcaactctctgaatcagaagccaaacaaaaag
atcctgatgtggctggtcggcttacagaatgtgttctctcatcagctccctagaatgccc
aaagagtatattacgcgcctggtctttgaccctaagcacaagacccttgctttaattaaa
gatggccgtgtgatcggtgggatctgtttccgtatgtttccgtcgcaaggattcacagag
attgtcttctgtgctgtaacttccaatgagcaagtcaagggctatggaactcacctcatg
aatcacctgaaagaataccatataaaacatagcatcctgaactttcttacgtatgctgat
gaatatgcaattggatacttcaagaaacaaggtttctccaaagatatcaaagtacccaaa
accaaatatgtaggctatatcaaggattatgaaggagccactctgatgggctgtgagcta
aacccaaggatcccatacacagaattttctgtcatcatcaaaaaacagaaggagatcatc
aagaaacttatagaaaggaagcaagcccagattcgaaaggtctaccccggactttcgtgt
tttaaagatggagtccgccagattccaatcgaaagcattcctggcatcagggagacaggc
tggaaaccaagtggaaaagaaagaggcaaagagcccaaagatcccgatcagctttatagt
acattaaaaaacatcctgcagcaggtgaagagccatcaaagcgcttggcccttcatggaa
cccgtgaagagaacggaagctcctggatattatgaagttataaggttccctatggatctg
aaaaccatgagtgaacgactcaagaacaggtactatgtatctaagaaattattcatggcc
gacttacagcgggtgtttaccaattgcaaagagtacaacccccctgagagcgaatactac
aaatgtgccaatatcctggagaaattcttcttcaccaaaattaaggaagctggattaatt
gacaagtga

DBGET integrated database retrieval system