KEGG   Monodelphis domestica (opossum): 100031247Help
Entry
100031247         CDS       T01031                                 

Gene name
RBKS
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100031247 (RBKS)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100031247 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 319 aa AA seqDB search
MAACVAGLQPDSAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAAR
LGAKTSLVCKVGKDSFGSDYIENLKRNDISTEFMYQTKDAATGAASIIVNNEGQNIIVIV
AGANLLLNSDDLRKAADIISRAKVIICQLEISPATSLEALTMARKSGVKTVFNPAPATAD
LDAQFYSVSDVFCCNESEAEILTGLKISSPAVAGKAGSVLIERGCKIVIITLGSEGCVFV
SAEEPGPKHIPTQKILKPVDTTGAGDSFVGALAFYLAYYPNLTMEEMIKRASFVASVSVQ
TSGTQSSFPYKKDLPLHLF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtgtgtggcggggctgcagccagactcggcggtggtagtggtgggctcctgc
atgaccgacctggtcagccttacatcacgtctgcccaaaactggagaaaccatccatgga
cataagttttttattggctttggaggaaaaggtgccaaccagtgtgtccaagcagcccgg
cttggagccaagacttctttagtgtgcaaggttggcaaagattcttttggcagtgattat
atagaaaacttaaagaggaatgatatttctacagaatttatgtatcagaccaaagatgct
gctacgggagctgcttcaataattgtcaataacgaaggacagaatattatcgtcatcgtg
gccggagcaaacttgctgttgaattctgatgacctgaggaaggcagctgatatcattagc
agagccaaagtaattatctgccagctagaaatatctccagctacttctctggaagccctg
acaatggcccgcaagagcggagtgaagacagtgtttaatcccgctcctgccacagctgat
cttgatgcacaattctattctgtctcggatgtgttctgctgcaacgagagtgaggctgag
attttaactggacttaaaattagcagccctgcagttgctggaaaagctggatcagtgctg
attgaaaggggttgcaaaatagttatcattactttgggttctgaaggatgtgtgtttgta
tcagctgaagaacctggcccaaagcatattcccacacagaagatcctcaagcctgtggat
actacgggggctggagatagttttgtgggagcactggccttctacctggcttattatcct
aacctgactatggaagaaatgatcaagagagccagcttcgttgcatcagtcagcgtccaa
acctcaggaacccagtcttctttcccttacaaaaaggacctgccacttcatctgttttga

DBGET integrated database retrieval system