KEGG   Monodelphis domestica (opossum): 100031263Help
Entry
100031263         CDS       T01031                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00562  Inositol phosphate metabolism
mdo01100  Metabolic pathways
mdo04015  Rap1 signaling pathway
mdo04020  Calcium signaling pathway
mdo04022  cGMP-PKG signaling pathway
mdo04062  Chemokine signaling pathway
mdo04070  Phosphatidylinositol signaling system
mdo04071  Sphingolipid signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04270  Vascular smooth muscle contraction
mdo04310  Wnt signaling pathway
mdo04371  Apelin signaling pathway
mdo04540  Gap junction
mdo04611  Platelet activation
mdo04621  NOD-like receptor signaling pathway
mdo04713  Circadian entrainment
mdo04720  Long-term potentiation
mdo04723  Retrograde endocannabinoid signaling
mdo04724  Glutamatergic synapse
mdo04725  Cholinergic synapse
mdo04726  Serotonergic synapse
mdo04728  Dopaminergic synapse
mdo04730  Long-term depression
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04911  Insulin secretion
mdo04912  GnRH signaling pathway
mdo04915  Estrogen signaling pathway
mdo04916  Melanogenesis
mdo04918  Thyroid hormone synthesis
mdo04919  Thyroid hormone signaling pathway
mdo04921  Oxytocin signaling pathway
mdo04922  Glucagon signaling pathway
mdo04924  Renin secretion
mdo04925  Aldosterone synthesis and secretion
mdo04926  Relaxin signaling pathway
mdo04927  Cortisol synthesis and secretion
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo04934  Cushing's syndrome
mdo04961  Endocrine and other factor-regulated calcium reabsorption
mdo04970  Salivary secretion
mdo04971  Gastric acid secretion
mdo04972  Pancreatic secretion
mdo05010  Alzheimer's disease
mdo05016  Huntington's disease
mdo05142  Chagas disease (American trypanosomiasis)
mdo05143  African trypanosomiasis
mdo05146  Amoebiasis
mdo05200  Pathways in cancer
Module
mdo_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100031263 (PLCB3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100031263 (PLCB3)
   04310 Wnt signaling pathway
    100031263 (PLCB3)
   04371 Apelin signaling pathway
    100031263 (PLCB3)
   04020 Calcium signaling pathway
    100031263 (PLCB3)
   04070 Phosphatidylinositol signaling system
    100031263 (PLCB3)
   04072 Phospholipase D signaling pathway
    100031263 (PLCB3)
   04071 Sphingolipid signaling pathway
    100031263 (PLCB3)
   04022 cGMP - PKG signaling pathway
    100031263 (PLCB3)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100031263 (PLCB3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100031263 (PLCB3)
   04621 NOD-like receptor signaling pathway
    100031263 (PLCB3)
   04062 Chemokine signaling pathway
    100031263 (PLCB3)
  Endocrine system
   04911 Insulin secretion
    100031263 (PLCB3)
   04922 Glucagon signaling pathway
    100031263 (PLCB3)
   04912 GnRH signaling pathway
    100031263 (PLCB3)
   04915 Estrogen signaling pathway
    100031263 (PLCB3)
   04921 Oxytocin signaling pathway
    100031263 (PLCB3)
   04926 Relaxin signaling pathway
    100031263 (PLCB3)
   04918 Thyroid hormone synthesis
    100031263 (PLCB3)
   04919 Thyroid hormone signaling pathway
    100031263 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100031263 (PLCB3)
   04916 Melanogenesis
    100031263 (PLCB3)
   04924 Renin secretion
    100031263 (PLCB3)
   04925 Aldosterone synthesis and secretion
    100031263 (PLCB3)
   04927 Cortisol synthesis and secretion
    100031263 (PLCB3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100031263 (PLCB3)
   04270 Vascular smooth muscle contraction
    100031263 (PLCB3)
  Digestive system
   04970 Salivary secretion
    100031263 (PLCB3)
   04971 Gastric acid secretion
    100031263 (PLCB3)
   04972 Pancreatic secretion
    100031263 (PLCB3)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100031263 (PLCB3)
  Nervous system
   04724 Glutamatergic synapse
    100031263 (PLCB3)
   04725 Cholinergic synapse
    100031263 (PLCB3)
   04728 Dopaminergic synapse
    100031263 (PLCB3)
   04726 Serotonergic synapse
    100031263 (PLCB3)
   04720 Long-term potentiation
    100031263 (PLCB3)
   04730 Long-term depression
    100031263 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    100031263 (PLCB3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100031263 (PLCB3)
  Environmental adaptation
   04713 Circadian entrainment
    100031263 (PLCB3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100031263 (PLCB3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100031263 (PLCB3)
   05016 Huntington's disease
    100031263 (PLCB3)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100031263 (PLCB3)
   04934 Cushing's syndrome
    100031263 (PLCB3)
  Infectious diseases
   05146 Amoebiasis
    100031263 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    100031263 (PLCB3)
   05143 African trypanosomiasis
    100031263 (PLCB3)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100031263 (PLCB3)
Membrane trafficking [BR:mdo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100031263 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100031263 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like C2 DUF1154 Antibiotic_NAT
Motif
Other DBs
NCBI-GeneID: 100031263
NCBI-ProteinID: XP_007506739
Position
Un
AA seq 1061 aa AA seqDB search
MFSADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKG
KPYLTLEQLLDFVNQKQRDPRLNEVLYPPLRPAQARLLIEKYEPNQQFLERDQMSMEGFS
RYLGGEENSVLPPEALDLSNDMTQPLSSYFINSSHNTYLTAGQLAGASSVEMYRQTLLWG
CRCVELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPFPVILSFENHVD
SAKQQAKMAEYCRTIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPPLSP
SDGSVRKRPLEQSNSALSESSVATEPPSPQLGSPSSEGCSTLSNGEDHVGCNPEPRKSID
REAESEEEEEEEPADPKKNSTDEGTASSEVNATEEMSTLVNYIEPVKFKSFEVARKRNKC
FEMSSFVETKALEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNAGCQLVAL
NFQTLDLPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEGIVDGIVANALRVKVIS
GQFLSDRKVSIYVEVDVFGLPADTRRKYRTRPSQGNSFNPVWDEEPFDFPKVVLPTLASL
RIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLIYTEASDYIPDDHQD
YAEALFNPIKHVSLMDQRSKQLAALIGESEAAPETPEERPSRQLGPQLSTGSVQSPQEPG
ASRTHGPSTSPTSPSISRPGQCDELIASLLGEVSVTPLAELRVHKALLKLRNRQERDLRE
LQKKQQRKAAAFLRRLHSHLAQYRADMEKRRKQQSQAGVLEEEEGEEMRSYRELQKKQLQ
SLLDLREAQADAEAERRQEHLRQAQHRLREIVLETHTTQLKKLKETSEKEKKELQKILDR
KRHNSISEAKIREKHKKEAELTEINRRHITESVNAIRRLEEAQKQRQERLVAGQLQVQQQ
LEEEEPKVASRLAQECQAQRARLPQEIRQSLWGELPVEQAAEEEEEEDLAAGDGPSLGTV
SGHTLGRASNGHALGGRASNGHAQGSGSGVDCERQEENTQL
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgttctctgcggacaagaagcgggtggagacggcgctggagtcctgcggcctcaatttt
aacaggagcgagtcgatccggccagacgagttttccctggagatctttgagagattcctc
aataaactgtgtctgcggcctgacatagacaagatcctgctggagattggggccaagggg
aagccctacctgaccctggagcagctcctggactttgtcaaccagaagcagcgcgacccc
cggctgaacgaggtcctgtacccgccgctgcgcccggcccaggcccgcctgctcatcgag
aagtacgagcccaaccagcagttcttggagcgagaccagatgtccatggaaggcttcagc
cgctacctgggcggggaggagaacagcgtcctgccgcccgaagccctggacctgagcaac
gacatgacgcagcccctgagctcctatttcatcaactcctcccacaacacctacctcaca
gcggggcagctggcaggggcctcgtcggtggagatgtaccggcagaccctgctctggggt
tgccgctgcgtggagttggatgtgtggaaaggccggccgcccgaggaggagcccttcatc
acccacggcttcaccatgaccacggaagtgcctctgcgggacgtgctggaggcgatcgcg
gaaacggccttcaagacgtcccccttccccgtcatcctctccttcgagaaccacgtggac
tcggcgaaacagcaggccaagatggcggagtactgccgcaccatctttggggacgcgctg
ctcatcgacccgctggataagtacccgctggccccaggagtccccctgcccagccctcag
gacctgatgggccgaatcctcgtgaagaataagaagcggcaccggccgcccctgagcccg
tcagacggctcggtgcgcaagcggcccttggagcagagtaactcggccttgagcgagagt
tccgtggccacggagcccccctccccgcagctcggctcccccagctccgagggctgttcc
actctgagcaacggagaagatcacgtgggctgcaaccccgaaccccgcaagtccatcgac
cgagaggcagagagtgaagaagaggaggaggaagaaccggccgaccccaagaagaacagc
acagacgagggcacggccagcagcgaggtgaacgccacggaggagatgtccactctggtc
aattacatcgagccggtcaagttcaagtcctttgaggtggcccggaagcggaacaagtgc
tttgagatgtcatcctttgtggagaccaaggccctggagcagctcaccaagagccccatg
gaatttgtggaatacaacaagcagcagctcagccgcatctaccccaagggcacccgggtc
gactcctccaactacatgcctcagctcttctggaacgcaggctgccagctcgttgccctc
aacttccagacactggacctcccaatgcagctgaatgccggcgtgtttgagtacaacggg
cgcagtggctacctgctcaagccagagttcatgcggcgcccggacaagtcttttgaccct
ttcacggaaggcatcgtggacggcatcgtggccaatgccctccgggtcaaggtgatctcg
ggccagtttctatcagacaggaaggtcagcatctatgtagaggtggatgtcttcggcctt
cctgcggacacacgtcgcaaataccgcactcggccctcacagggcaactcctttaacccg
gtgtgggacgaggagccctttgacttccccaaggtggtgctgcccaccttggcctccctc
cgcattgcggcctttgaggaagggggcaagtttgtgggacaccgaatcctgccagtgtcc
gccattcgctcagggtaccattacatctgcctgaggaatgaggccaatcagcccctgtgt
ctgcctgccctgctcatctacacagaagcttctgactacatccctgatgatcaccaggac
tatgccgaggctttgttcaaccccatcaaacatgtcagcctcatggaccagagatcaaag
caattggcagctctgattggtgagagtgaggctgctcccgagaccccagaggagaggcct
tctcgccagctagggccccagctgtccacgggctccgtccagagcccccaggaacctgga
gcctcccgcacccatggcccttccacctcccccaccagcccttccataagcagaccaggt
cagtgcgatgagctcatcgccagcctcctgggagaggtatctgtgacccccttggcggag
ctccgggttcacaaggccctgctgaagctccggaaccggcaggagcgagacctgcgggag
ctgcagaagaagcagcagcgcaaggcggcggccttcctacggcgcctccacagccacctg
gcccagtaccgggccgacatggagaagaggcgcaagcagcagtcccaggccggggtgctg
gaggaggaagagggggaagagatgcggagctatcgggagctgcagaagaaacagcttcag
agtctgctggacctgagggaggcccaggccgacgcggaagccgaacgtcgccaggaacac
ctgagacaggcccagcatcgccttcgcgagattgtccttgaaacgcacacgactcagctg
aaaaaactgaaggagacgagtgaaaaggagaagaaggagctgcagaagattctggaccgg
aagagacataatagcatttctgaagccaagatccgggagaagcacaagaaggaggcggag
ctgactgagattaaccggcgtcacatcacggagtcggtcaacgccatccggaggctggag
gaggcccagaagcagcgccaggagcggctggtggccggccagctgcaagtccagcagcag
ctagaagaggaagagcccaaggtggcctcccggctggcccaggagtgccaggcccagcgg
gcacggctgccacaagagatccgacagagcctgtggggtgagctgccggtggagcaggcg
gcggaggaggaggaggaggaggaccttgctgcaggcgatggtcccagcctgggcactgtc
agcgggcacacgctgggcagagccagcaatgggcacgccctggggggcagagccagtaat
gggcatgcccaggggagtggcagtggtgtagactgtgagaggcaagaagagaacacccag
ctgtga

DBGET integrated database retrieval system