KEGG   Monodelphis domestica (opossum): 100031295Help
Entry
100031295         CDS       T01031                                 

Definition
aromatase-like
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100031295
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100031295
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     100031295
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP19 family
   100031295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 503 aa AA seqDB search
MILEMLNPMHYNLTGMVPEAMPAATMPILLLTCFLLLVWSYEDTSLIPGPGYCMGIGPLL
SHGRFLWMGIGSACNYYNKMYGEFMRVWICGEETLIISKSSSMFHIMKHSHYISRFGSKL
GLQCIGMHENGVIFNNNPALWKAIRPFFTKALSGPGLVRMVAVWYNSTVIHLDKLEDVTN
ELGYGHVLNLMRRIMLDTSNVSLLGIPLDENAIVVKIQSYFDAWQALLLKPDIFFKISWL
YKKYEKSVKDLKDALEILIEEKRHRLSTDDKLEDCMDFASQLIFAQGRGDLTGENVNQCI
LEMLIAAPDTLSVTVYFMLLLIAKHPKVEEAVMKEIQTVIGERDIKIGDVQKLKVVESFI
YESMRYQPVVDLVMRKALQDDVIDGYPVKRGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPHRYFQPFGFGPRGCAGKYIAMVMMKVILVTVLRRFHVQTLTGCCLERIQKKNDLSLH
PDETRDFLEMIFIPRNTEKCQEQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggaaatgctcaatccaatgcattacaacctcactggcatggtacctgaggca
atgccagctgctactatgcctatcctcctcctcacctgctttcttctcttggtttggagt
tatgaagatacttccttaataccaggtcctggttactgtatgggaattggtcccctcctt
tcacatggcagatttctatggatgggaataggcagtgcctgtaactattacaacaagatg
tatggtgaatttatgagagtatggatctgtggagaggagactctcattataagcaagtct
tcaagtatgtttcacataatgaaacatagtcactatatttctaggttcggaagcaaactt
gggttacagtgtattggaatgcatgaaaatggtgtcatatttaataataatccagctctc
tggaaagctattcgacctttctttacaaaagctttgtctgggccgggtcttgtgcgcatg
gtggctgtttggtataactcaactgtaattcatctggacaaactagaagatgtcaccaat
gaactgggttatggtcatgtgctgaacctcatgagacgcattatgttggatacctccaat
gtctctctcttgggtattcctctggatgaaaatgccattgtggtcaaaatacagagctat
tttgatgcttggcaagctctccttctcaaaccagacatcttctttaagatatcttggcta
tacaaaaagtatgaaaagtctgtcaaggatttgaaggatgccctagaaatcttaatagag
gaaaaaagacataggctttctacagatgataaactggaagactgtatggattttgcttca
caattgatttttgcccagggtcgtggagacttgacaggtgagaatgtgaaccaatgcatc
ctggaaatgctgattgctgctccagacaccctatctgtcactgtgtacttcatgttactg
ctgattgcaaagcacccaaaggtcgaagaagcagtaatgaaggaaatccaaactgttatt
ggtgagagagatattaagatcggtgatgtgcaaaaattgaaagtagtagaaagttttatt
tatgagagcatgagataccaacctgttgtggacttggtcatgcgcaaggctttgcaagat
gatgtgattgatggctatccagtgaaaagaggaactaatattatcttgaatattggaagg
atgcatagactcgagtttttcccaaagccaaatgaatttactcttgaaaactttgcaaag
aatgtacctcatcgttattttcaaccatttggttttggccctcgtggctgtgcaggaaaa
tacattgccatggtaatgatgaaagtcatccttgttacagtgttgaggaggttccatgta
cagacattgacaggatgctgtcttgaacgcattcagaaaaaaaatgacttgtctttgcat
ccagatgagaccagggactttctggaaatgatttttattccaagaaacacagaaaaatgc
caagaacaataa

DBGET integrated database retrieval system