KEGG   Monodelphis domestica (opossum): 100031295Help
Entry
100031295         CDS       T01031                                 

Definition
cytochrome P450 19A1-like
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mdo00140]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:mdo04913]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 503 aa AA seqDB search
MILEMLNPMHYNLTGMVPEAMPAATMPILLLTCFLLLVWSYEDTSLIPGPGYCMGIGPLL
SHGRFLWMGIGSACNYYNKMYGEFMRVWICGEETLIISKSSSMFHIMKHSHYISRFGSKL
GLQCIGMHENGVIFNNNPALWKAIRPFFTKALSGPGLVRMVAVWYNSTVIHLDKLEDVTN
ETGYGHVLNLMRRIMLDTSNVSLLGIPLDENAIVVKIQSYFDAWQALLLKPDIFFKISWL
YKKYEKSVKDLKDALEILIEEKRHRLSTDDKLEDCMDFASQLIFAQGRGDLTGENVNQCI
LEMLIAAPDTLSVTVYFMLLLIAKHPKVEEAVMKEIQTVIGERDIKIGDVQKLKVVESFI
YESMRYQPVVDLVMRKALQDDVIDGYPVKRGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPHRYFQPFGFGPRGCAGKYIAMVMMKVILVTVLRRFHVQTLTGCCLERIQKKNDLSLH
PDETRDFLEMIFIPRNTEKCQEQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggaaatgctcaatccaatgcattacaacctcactggcatggtacctgaggca
atgccagctgctactatgcctatcctcctcctcacctgctttcttctcttggtttggagt
tatgaagatacttccttaataccaggtcctggttactgtatgggaattggtcccctcctt
tcacatggcagatttctatggatgggaataggcagtgcctgtaactattacaacaagatg
tatggtgaatttatgagagtatggatctgtggagaggagactctcattataagcaagtct
tcaagtatgtttcacataatgaaacatagtcactatatttctaggttcggaagcaaactt
gggttacagtgtattggaatgcatgaaaatggtgtcatatttaataataatccagctctc
tggaaagctattcgacctttctttacaaaagctttgtctgggccgggtcttgtgcgcatg
gtggctgtttggtataactcaactgtaattcatctggacaaactagaagatgtcaccaat
gaaactggttatggtcatgtgctgaacctcatgagacgcattatgttggatacctccaat
gtctctctcttgggtattcctctggatgaaaatgccattgtggtcaaaatacagagctat
tttgatgcttggcaagctctccttctcaaaccagacatcttctttaagatatcttggcta
tacaaaaagtatgaaaagtctgtcaaggatttgaaggatgccctagaaatcttaatagag
gaaaaaagacataggctttctacagatgataaactggaagactgtatggattttgcttca
caattgatttttgcccagggtcgtggagacttgacaggtgagaatgtgaaccaatgcatc
ctggaaatgctgattgctgctccagacaccctatctgtcactgtgtacttcatgttactg
ctgattgcaaagcacccaaaggtcgaagaagcagtaatgaaggaaatccaaactgttatt
ggtgagagagatattaagatcggtgatgtgcaaaaattgaaagtagtagaaagttttatt
tatgagagcatgagataccaacctgttgtggacttggtcatgcgcaaggctttgcaagat
gatgtgattgatggctatccagtgaaaagaggaactaatattatcttgaatattggaagg
atgcatagactcgagtttttcccaaagccaaatgaatttactcttgaaaactttgcaaag
aatgtacctcatcgttattttcaaccatttggttttggccctcgtggctgtgcaggaaaa
tacattgccatggtaatgatgaaagtcatccttgttacagtgttgaggaggttccatgta
cagacattgacaggatgctgtcttgaacgcattcagaaaaaaaatgacttgtctttgcat
ccagatgagaccagggactttctggaaatgatttttattccaagaaacacagaaaaatgc
caagaacaataa

DBGET integrated database retrieval system