KEGG   Monodelphis domestica (opossum): 100031489Help
Entry
100031489         CDS       T01031                                 

Gene name
SRD5A2
Definition
(RefSeq) steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
  KO
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100031489 (SRD5A2)
 Human Diseases
  Cancers
   05215 Prostate cancer
    100031489 (SRD5A2)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100031489 (SRD5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 301 aa AA seqDB search
MPTVCLLNPVLAGSALLAGLGLLKLLSSSPDAYGKQAERLLPLATRLPARAAWFLQELPS
FVVPIGLLAWQPHPLFGPPGTLLLGLFCGHYFHRYPPPALGFSSSFLTHLQAAPVSWAAS
LLPGFLGSSWQIARGTEEVKLRSFSIPRDLLAISPSVGRCSPGQNRRVRVRSKAADLPER
RKSSRLVSLKTQASEGILLFFLGMAINIHSDYLLRQLRKPGEISYKIPQGGLFTYISGAN
YFGEIVEWIGYAMATWSFPGLAFAFFSSCFLGKRAYYHHRFYLKKFQDYPKSRKALIPFI
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcccacggtgtgcctactgaacccggtgctggcgggcagcgctctgcttgctggttta
gggttgttgaagttgctgagctccagccccgacgcgtatggcaaacaggctgagcgcctg
ttgcccttggccacccggttgccagcccgcgcagcttggttcctccaggagctcccctct
ttcgtggtgcccattgggctgctcgcttggcagccccacccgctcttcggcccgccgggg
accttactgcttggcctcttctgcggacattactttcacaggtacccgccgcccgccctt
ggcttttcctcctctttcctcacccacctgcaagctgctccagtatcttgggctgcgtct
ttgctcccagggttcctgggttcctcgtggcaaatagccagaggaactgaggaagtcaag
ttgaggtccttttctattcccagagacctgctggctatcagtccatctgttggccgatgc
agcccaggacagaacagaagagtccgggttaggagcaaggcagcagacttgccagaacgc
aggaaaagtagtcggttggtcagcctgaagacacaggcttctgaaggtatcctcttattt
tttttgggaatggcaatcaatattcacagtgactacttgctgcgtcaactcagaaaacct
ggagaaatctcctataagattccacaaggaggattattcacttacatatctggagccaat
tattttggtgagattgtggaatggattggctatgccatggcaacctggtccttcccaggc
ttggcatttgcctttttttcatcatgtttccttggaaaacgagcttattaccatcacagg
ttctatctcaagaagtttcaagactaccctaagtctaggaaagccttgattcctttcata
ttttaa

DBGET integrated database retrieval system