KEGG   Monodelphis domestica (opossum): 100031506Help
Entry
100031506         CDS       T01031                                 

Gene name
UNC13C
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Synaptic vesicle cycle
Class
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:mdo04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 2224 aa AA seqDB search
MVANLFKSLILPYLHKLYKGMFTKKLGNTTKKKENCSRPKEQATTLSGQIKPPKFSRTLK
STVKKIAKCSSARNLSIEEDEVSREYSLSPTFSYRVAIANGLQKNIVVTNNSNEELVQEL
SSIESSYSESLSEIKDSGEIKDNGEIKEYSSHTMPVRRNRKSLSSLAPSEGSSDGERTLH
SLKLGALRKLRKWKKSQEFVSSDSELSTMKKTWGLRSKSLDRTARPQKTNTLEPGFSSSG
CISQTHDVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTG
FVQSRRETRDIHDYIKQISHTGSKASLRFLNVPEERFEYVENVVYRILIDKMGFSDAPHA
IKIEFAQRIGQQRDCPNAKPRPILVYFETPQQRDFILKKSYKLKGTGIGVSTDILTHDIR
ERKDRGMPTSQTYESMDMKLSTLESKIKRSSWQSPDDSDKDLDSDLNKNSYAMISKSDFQ
TKASAPKSNAKSHNARSRNRTADSSKFSNKSDYDEQAPQFSESDNLEKESKAYYADMAPL
WHSQSDFLTPKLSRSESDFSKLCQSYSEDFSEHQFFTRTNGSSLLSSSDRELWQRRQDGT
SNWYSSSQDQNFNRNIQNDQGPREIENTETVDSGVSNGVVCVSGDRSNYSDSQISLRDDL
SPWKDWNQSEQGADLGLDSSTQEGFDYDTNSLSDPQLDGDNKDLDDLGKCHSDLPDDSES
YDFTLDDNSSPCPGLDNETQGQWVGPYDTYQEANSNETYPNQNQLPMLYRSQSELPSDAS
EDAAPKSWHSRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMG
RFRTLSQSTANESSTTLDSDVYTEPYYYKAEDEEDYSEPGAEHETDYVEVMEQVLAKLEN
RTSIPEMDDNIQEYEHPSYETPYETPQDEGYDGQVDDLMSEGGMESLNGTITEMEIREDE
NQNVPEKPPEDPPKPKRIRPSFKEAALRAYRKQMAELEEKILAGDSSSVDEKARIVSGSG
LDASQFSALQAFGGAGRGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTS
LNNEELKMHVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCME
CGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIRERNRPEVFEVIQ
EMFHVSKEDFVQYTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVG
KNKRRTKTIFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLG
QTIVEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENL
FHYLTEVKFNGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGVESIYQAMTHFSCLSS
KYMCPGVPAVMSTLLANINAFYAHPTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSL
RIDLSKYRDNFPASNSERLQDLKSTVDLLTSITFFRMKVLELQNPPRASTVVKDCVRACL
DSTYKYIFDNCHELYTQLIDPSKKQDISRDDQGPTTKNLDFWTQLITLMITIIDEDKTAY
TPVLNQFPQELNMGKVSAEIMWTLFALDIKYALEEHEKQRLCKSTDYMNLHFKVKWFYNE
YVRELSAFKDAVPEYSLWFEPFVIQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFS
CSVVDVFAQLNQSFEIIKKLECPNPEALSHLMRRFAKTISKVLLQYAAIISNDFSSYCDK
ENVPCILMNNIQQLRVQLEKMFESMGGKELDPEASSVLKELQVKLNGVLDELSVTYGESF
QLIIEECVKQMSLELNQMKGNGNTTSNKNNAAMDAEIVLRPLMDFLDKTLSLSAKICEKT
VLKRVLKELWKLVLNKIEKQIVLPPLTDQTGPQMIFSAAKDLGQLSKLKDHMIREEAKGL
TLRQCAVMEVVLATIKQYFHAGGNGLKKNFLEKSPDLQSLKYALSLYTQTTDSLIKKFID
TQTSQNRSRNDSVGQISVHVDISTIPGTGDHKITVKVIAINDLNWQTTAMFRPFVEVFIL
GPNLGDKKRKQGTKTKSNTWSPKYNETFQFILSNENRPGAYELHLSVKDYCFAREDRVIG
MTVIQLQNIVEKGSSGAWYPLLKNIFMDDTGLTILRILSQRTNDDVAKEFVRLKSDTRST
EEIA
NT seq 6675 nt NT seq  +upstreamnt  +downstreamnt
atggttgctaacctttttaagagcttgatcttaccttatctccataagctttataaagga
atgtttacaaagaaattgggaaatactacaaaaaagaaagaaaattgctctcgccccaaa
gagcaagccactactctctctggccagatcaaaccccctaaattttctaggaccttaaaa
agcactgttaaaaagattgccaagtgctcgtctgctcgcaacttgtccatagaagaagac
gaggtcagtagagaatattccctctctcccacattcagttatcgtgtggcgattgctaat
ggactgcaaaagaacattgttgtaacaaacaacagtaatgaagaactggttcaagagcta
tcttctattgagagctcctactcagaatcattaagtgagatcaaggacagcggtgagatc
aaggacaacggtgaaatcaaggagtactcctcacacacaatgccagtaagacgcaacaga
aagagcctgagcagcctggctccctcggaaggaagctcagatggggagcgcacattacat
agtctgaaactaggagccttacgcaaattgaggaaatggaaaaagagccaagagttcgtt
tcctctgattcagagttgagcacaatgaaaaaaacatggggactccgaagcaaatcctta
gacagaactgcccgtccccagaaaacaaacactctggaacctgggttcagttcatcaggc
tgcattagccaaacccatgatgttatggaaatgatatttaaggaacttcagggaataagc
cagattgaaacagaactttcagaattaagaggccatgtcaatgctctcaaacactccatt
gatgagatctctagcagtgtggaggttgtccaaagtgagatagaacagctccggacaggt
tttgtccagtcccgaagggaaaccagagatattcatgattatattaaacaaataagtcat
actggaagcaaagcgagcctgagatttttaaatgtgcccgaagaaagatttgaatatgtt
gaaaatgtcgtataccggattctcatagataaaatggggttttcagatgcacctcatgca
ataaaaattgaatttgctcaaaggatagggcagcaaagggattgtccaaatgcaaagcct
cgccccatacttgtatactttgaaacaccacaacagagggatttcatattgaaaaagtct
tataaacttaaaggaacaggcattggggtgtccacagatattttaacccatgacatcaga
gaaagaaaagacagaggaatgccaacctcccaaacctacgagagcatggacatgaagctc
tccactcttgagtccaaaatcaaaaggagcagttggcagtccccagatgatagtgataaa
gatctggattctgatcttaataaaaatagttacgctatgatatcaaagtcagactttcaa
accaaagcaagtgctccaaagtcaaatgcaaagtctcataatgctagaagcaggaataga
actgctgacagcagcaaattttcaaataaatcagactatgatgaacaagctccacagttt
tctgaatctgataatttggagaaggaatccaaggcttattatgctgatatggctcccctc
tggcactcacaaagtgattttctcacaccaaaactgagccgttctgaatcagatttttcc
aaactatgtcaatcttattctgaagacttttcagagcatcaattttttaccaggacaaat
ggaagttctctcttgtcttcttcagacagagaactttggcagaggagacaagatggcact
tctaactggtatagcagttcccaggaccagaactttaacaggaatattcaaaatgaccaa
ggtcccagagaaatagagaacactgaaacagtggacagtggtgtcagtaatggagtggtg
tgtgtgtcaggagacagaagtaattacagtgattctcagatctctttacgagatgatctc
tcaccatggaaagactggaatcaatcagaacaaggggctgatttgggtcttgactcatct
acacaggaaggttttgactatgacaccaacagtctgtcagacccacagctggatggtgac
aacaaagatctggatgacttaggaaagtgccacagtgaccttccagatgactcagagagc
tatgattttaccttagatgacaattcttccccatgcccagggttggataacgaaacacaa
ggccaatgggttggcccatatgatacttatcaggaagctaattctaatgaaacctaccca
aatcaaaatcaactgccaatgctgtatcggagtcagagtgagctaccaagtgatgcctca
gaggatgctgcacccaagtcatggcatagcagattgagcatagacctgtctgataagaca
tttagttttccaaagtttgggtctacccttcagagagctaaatcagctttggaagttgtg
tggaataaaagtactcagagtctaagtggatatgaagacagtggatcatccttaatggga
cgatttagaactttatcccagtctactgcaaatgagtcaagtaccacccttgattctgat
gtctacactgaaccatattattacaaagcagaggatgaagaagactacagtgaacctgga
gctgaacatgaaacagattatgtagaagtgatggagcaagttcttgctaaactagagaac
agaactagcattcctgaaatggatgataacattcaggagtatgaacatccatcatatgaa
actccttatgaaacaccacaggatgaggggtatgatggacaggtggatgacctgatgagt
gaagggggaatggaatctttaaatggaacaattactgaaatggaaataagggaagatgaa
aaccagaatgtcccagaaaagcctccagaggatcctccaaaacccaagaggattcggcct
tctttcaaagaagctgccttaagggcatacaggaagcaaatggcggaactggaagagaag
attttagctggagatagcagttctgtggatgaaaaggctcgaatagtaagtggaagtggt
ctggatgcttcccaattcagtgctctccaagcatttgggggggctggcaggggactctat
ggtattgacagtatgcctgacctccgcaggaaaaaaaccttgcctattgttcgagatgtg
gccatgacattagctgctcgaaaatctggactctccttggccatggttattaggacatct
ctgaacaatgaggagttgaaaatgcatgtctttaaaaagactctacaagcactgatctac
ccaatgtcatccaccactcctcacaattttgaggtgtggacagctaccaccccaacctac
tgctatgaatgtgaaggtcttctgtgggggatagcgagacaaggcatgaagtgtatggag
tgtggtgtgaaatgtcatgaaaagtgtcaggaccttctcaatgctgactgtttgcagaga
gctgcagagaagagttctaagcatggtgctgaagataagactcagaccatcattactgcc
atgaaagaacgaatgaagataagagagagaaataggccagaagtgtttgaagtaattcag
gaaatgttccatgtttccaaagaagattttgtacaatatacaaaggcggccaaacagagt
gttttggatgggacatctaagtggtcagcaaaaataaccatcacagtggtttctgcccaa
ggcttacaggctaaagacaaaacaggatcaagtgatccatatgttacagttcaagttgga
aagaacaagagaagaaccaaaactatttttggaaacttaaatccagtctgggatgaaaag
ttttattttgaatgccataactccaccgatcgtataaaagtcagagtgtgggatgaagat
gatgacataaaatcaagagtcaagcaacatttcaaaaaggaatcagatgattttttggga
caaacaattgttgaagtgaggacactgagtggagaaatggatgtttggtacaacctagag
aaacggactgataaatcagctgtatctggtgccattaggctgaaaatcaatgttgaaata
aaaggagaggagaaggttgcaccatatcatatacagtacacatgtttgcatgagaacctg
ttccattacttgactgaagttaaatttaatggtggtgtgaaaatcccagaagtcaaagga
gatgaagcctggaaggttttctttgatgatgcatcccaagaaatagtagatgaatttgca
atgcgttatggagttgagtctatttatcaagcaatgacgcacttttcatgtctgtcttcc
aagtacatgtgcccgggcgtcccagcagtgatgagtaccctattggcaaacataaatgct
ttttatgcccacccaacagtttcaactaatgtacaagtatctgcctcagatcggtttgct
gctaccaactttggtagggaaaagttcataaaactactggatcagttgcacaattctttg
aggattgatttatcaaagtacagggacaactttcctgctagcaattcagagagacttcaa
gatctgaaatcaactgttgacctgctaacaagcattaccttttttcgaatgaaggttttg
gaactccaaaatccacctagagccagcactgttgtgaaggattgtgtcagggcttgctta
gattccacatacaagtatatttttgacaactgccacgaactttacacacagctaatagat
ccgagtaagaaacaggacatttctcgggacgaccagggtccaaccaccaagaatttggat
ttttggacccagctcatcactctgatgattacaattattgatgaagataaaactgcatac
acacctgtcctgaatcagttccctcaagaactaaacatgggaaaagtcagtgctgagatc
atgtggacactctttgcactggatattaagtatgcactggaagaacatgaaaagcagcgg
ttatgcaagagtaccgattatatgaatttgcatttcaaagtaaaatggttttataatgaa
tatgtgcgagagctctctgccttcaaagatgctgttcctgaatactctttatggtttgag
ccttttgtcattcagtggctcgatgaaaatgaagatgtgtcaatggagtttcttcatggt
gcactaggaagagacaaaaaagatggattccagcagacctcagaccatgccctcttctct
tgctccgtggtagatgtctttgcacagcttaatcagagctttgagattatcaagaaattg
gagtgccctaatcctgaagcattatcccatttgatgagaagatttgcaaagaccatcagt
aaagttctactccagtatgctgcaattatctccaatgatttcagttcatattgtgataaa
gaaaatgtgccctgtattttgatgaacaacattcaacaactgcgggtccagctggaaaag
atgtttgaatccatgggagggaaagagctagatcctgaagctagtagtgttctcaaagaa
cttcaggtaaaactcaacggggtcctggatgaactcagcgtaacctatggtgaaagtttc
cagcttataattgaagaatgtgtgaagcagatgagtttagaattgaatcaaatgaaagga
aatggaaataccacttccaacaagaacaatgcagctatggatgcagaaattgtactaaga
cctcttatggacttcttagataaaactttaagtctttctgcaaaaatctgtgaaaagaca
gtgctgaagagggttttgaaagagctgtggaagctcgtcctcaacaaaatagaaaagcag
attgttcttcctcctttgacagatcaaacaggaccacaaatgatttttagtgcagctaaa
gatcttggacaactatctaaactgaaggatcacatgattcgagaggaagccaaaggcctg
accctaagacagtgtgctgtcatggaagtagtcctagccacaatcaagcaatattttcat
gctggaggaaatggtctgaaaaagaattttttggagaagagccctgatctacagtctctt
aaatatgctctcagtctttatacccaaaccactgattccctgataaagaaattcatagac
actcaaacctctcagaatcgctctcgcaatgactcagtgggacagatatcagttcatgta
gacatctcaaccattccaggaactggggaccacaaaataactgtaaaagtaattgccatc
aatgatttaaactggcaaaccacagcaatgtttcgcccctttgtcgaggtttttatcctg
ggacccaaccttggtgacaagaaaagaaaacaaggtaccaagaccaagagcaacacctgg
tcgccaaagtacaatgaaactttccagttcatcctgagtaatgaaaaccgcccaggggcc
tatgaacttcacctctcagttaaagattactgctttgcacgggaagatcgagttatagga
atgacagtgattcaactccagaatatagtggagaaaggaagctccggggcatggtatcca
ctgttgaaaaacatctttatggatgatactggcttgacaatccttaggatactttctcaa
aggaccaatgatgatgtggctaaagaatttgtaagactgaagtctgatacaagatccaca
gaagagattgcctga

DBGET integrated database retrieval system