KEGG   Monodelphis domestica (opossum): 100031679Help
Entry
100031679         CDS       T01031                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  apolipoprotein A-IV
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04975  Fat digestion and absorption
mdo04977  Vitamin digestion and absorption
mdo04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100031679 (APOA4)
   04979 Cholesterol metabolism
    100031679 (APOA4)
   04977 Vitamin digestion and absorption
    100031679 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein YtxH Baculo_PEP_C DUF883 ApoLp-III DUF885 DUF4407 KapB Prominin Gp58 ApoA-II DUF4014 KMP11 DUF2397 FliT Apo-CIII Phasin SF-assemblin Exonuc_VII_L DUF1845 WXG100 Lipase_GDSL DUF1931 AI-2E_transport BshC Fibritin_C DUF1216 DASH_Ask1 DUF4085 BLOC1S3 ParcG Mst1_SARAH Laminin_II
Motif
Other DBs
NCBI-GeneID: 100031679
NCBI-ProteinID: XP_001380874
Ensembl: ENSMODG00000013802
UniProt: F6TDB8
Position
4
AA seq 371 aa AA seqDB search
MFLKAVLLSLAFVAIASVQAETQPDQISQIVWDYFNKLSANAKDAMEQLQNSELNQQFNT
LLQDKLGEVSTRTNDLTKKILPFAMELPTRLVQDSERLKTQIQREMEELRVQIQPFAEQV
NQKMTDNVQTLKKHVVPYTSELQTHLSENVEQLQQQLAPFVQQLDEAMKENLKSLQTDII
PLANQFKDKVNQQVDNIKGQLIPYADRIQGKIDEHIEELRKTLTPFATGAQDQLNRQLES
LAFQMKKNVEQLRTKISENTEDLKQKLTPFAEDIQGKIPGNSEELYQSLTKVRGQMNQHI
EEFRRNIGPQGEAFNTALVQHLEELKKKLGSHSGEIEDHLGLLEKGLRDKVNSFFSSLQE
SQEEMPADPKP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcaaagctgtgctactctctctggcctttgtggctatcgccagtgtccaggct
gagacacaacctgaccagatatcccagatagtatgggattatttcaacaaactgagtgcc
aatgccaaggatgccatggaacagctacagaattctgagttgaaccagcagttcaatacc
cttttgcaggacaagttgggggaggttagcacacgcaccaatgacctgacgaagaagata
ctgccctttgccatggaattacccacccgtttggtccaggactcagaaagactgaagact
cagatccagagggagatggaggagcttcgagtccagatacagccctttgcagaacaggtc
aaccagaagatgactgacaatgttcagaccctgaagaagcacgtggtgccctacaccagt
gagctccaaacccatctcagtgagaatgtggagcaactccaacagcagctggcccccttt
gttcagcagctggatgaagccatgaaggagaacttgaagagcttgcagactgacataatc
ccccttgccaaccagttcaaggacaaggtcaaccagcaagtggacaatataaagggccag
ctcatcccttatgctgaccggatccaaggcaagattgacgagcacatagaagagcttcgc
aagaccctcacgccttttgctactggtgcccaggaccagctcaaccgtcaacttgaaagt
ctggctttccagatgaagaagaatgtagaacagttgaggaccaagatctctgagaacaca
gaagacctgaagcaaaaactgacaccctttgctgaggacattcagggaaagattccagga
aattcagaggagctgtaccagtccctgaccaaggtgagaggacagatgaaccagcacatt
gaagagttccgcaggaatattgggccccaaggagaggccttcaacacagccttggtgcaa
catctagaagagctcaagaagaaactaggatcccactctggtgaaatagaggaccacctg
ggcctcttggagaagggcctgagggacaaagttaattccttcttcagtagcctccaggag
agccaggaggagatgcctgctgatcccaagccctag

DBGET integrated database retrieval system