KEGG   Monodelphis domestica (opossum): 100031700Help
Entry
100031700         CDS       T01031                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    100031700 (USP1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100031700 (USP1)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100031700 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 799 aa AA seqDB search
MPGVLPSESHGLLAARGSPKKSRLSLKFFQKKETKRALDFTGDVQDDEDRGPPEAGGAGG
AAAPEVDQVVPATGVAQPSPLGTCDKRETLLPFVGLNNLGNTCYLNSILQVLYFCPGFKT
GVKHLFNVITKKKEILKDETNQKVEKGNGKDDNLASYELICSLQSLIISVEQLQANFLLN
PEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEELKNM
PGELEEKPSPREGSEINAPDDDGVASSADGKDKISKGNGKRKSDSEVGNPKKKSKLTKEQ
TSSEENQRQTRSKRKATGDTARSESSPEATPKCATEGDPARPTQKKSRLKLNWLKPTTKQ
PSILSKFCSLGKITTHSGPKGHSREADDGDHEEDFKCEPRSYLKDESGEPAPPGRSMEDK
ETQALRNKGMEQVCFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEEEFSKV
EESSEISPEPKTELKSLKWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVI
TIHLKCFAATGLEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGIT
ISSGHYTASVKVTDLHSLELDTEHFMVDQTDEMGKPDPLGEEEAKALAEDYDDEVAFRVS
GSSQASKVLNKKNVEAVGLLGGQKSKPDYEFYNSHKAANPEKVVGAAAESRNSESSSTAG
AQELDRDKEPSGHMDAHANGPENKASYVLQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLS
PATSSTSTPYLLFYKKIIE
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgcccggggtcctgcccagtgagagccacgggctgctggcggccagggggagccccaag
aagagccgcctatctctcaagttcttccagaagaaggagaccaagagggccctggacttc
acgggggatgtgcaggacgatgaggatcgtgggcctcccgaggcggggggagccggagga
gcagccgcccccgaagttgatcaagtggtgcccgcaactggagtggcccagccctccccc
ttgggcacctgcgacaagagggagaccctcctgcccttcgtggggctcaacaacttgggc
aacacgtgctacctgaacagcatcctgcaggtgctgtacttttgtcctggatttaaaact
ggagtcaaacacttgtttaatgtcattacaaagaagaaagaaatcctcaaggatgaaacc
aatcaaaaagtggagaagggaaatggcaaagacgacaacctggcaagttatgaattaata
tgcagtttacagtctttaataatttcagttgaacaacttcaggccaattttcttttgaat
ccagagaaatatacggatgaacttgctactcagccacggcggctacttaacactctcagg
gagctgaatcccatgtatgaaggatatctccagcatgatgctcaggaagtattgcaatgt
atcttgggaaacattcaggaaacatgtcagctcttaaagaaggaggaactgaagaacatg
ccaggagagctggaggaaaagccttctccaagagaaggcagtgaaattaatgccccagat
gatgatggagtggcaagctctgcagatgggaaggacaagatctccaaggggaatggtaaa
aggaaaagcgacagtgaagtggggaatcccaagaagaagtctaagctgaccaaggagcag
acgtcatctgaagagaaccagagacagaccaggtccaagagaaaggccactggggacact
gctcgctctgaaagttctcctgaagcgacccccaagtgtgccactgaaggtgaccctgcc
cgaccgacccagaagaaatcaagactcaagctaaactggctaaagcccacgacaaagcag
cccagcatcctttccaagttctgtagtctggggaagatcacgacgcactcgggacccaaa
ggacattccagagaagccgacgatggcgatcacgaagaggatttcaagtgtgaacccagg
agctacttgaaagatgagtctggggagcctgcaccccccggcaggagcatggaggacaaa
gaaacgcaggccttaagaaacaaagggatggaacaagtttgttttgagctggtggagaag
ttattccaaggccagctggttttgagaactcggtgcttggagtgtgagagcttaacagag
agaagggaagacttccaggacatcagtgtgccggtccaagaggaggagttttccaaagtg
gaggagagttcagaaatttcaccagagcccaagacggagctcaagagtctcaagtgggcc
atctcgcagtttgcctcggtggagaggattgtgggggaggacaagtacttctgcgagaac
tgccatcattacacagaggcggagcgcagcctcctctttgacaagatgcccgaggtcatc
accatccacctgaagtgtttcgccgccactggcttggagtttgactgttatggtggcggc
ctttccaagatcaacactcccctgctgacgcccctgaagctgtccctcgaagaatggagc
acgaagccgaccaacgacagctatggactgtttgcggtcgtgatgcacagtggcatcacc
atcagcagcggccactacactgcatccgtcaaagtcactgacctgcacagcttggagcta
gacacggaacacttcatggtggaccaaacggacgagatggggaagcccgaccccctgggc
gaggaggaagccaaggctctggccgaagactacgacgacgaggtagccttcagggtcagc
gggagctcccaggccagcaaagttctgaacaaaaagaacgttgaggccgtcggacttctc
ggaggacagaagagcaagccggactatgagttttataacagccacaaagcggcgaatccc
gagaaggtggttggggctgcggctgaaagcagaaactccgagtccagcagcaccgctggg
gcccaggagctggacagagacaaggagcccagcggccacatggacgctcatgcaaacggg
cccgaaaacaaagcctcctacgtgctccagagcttgaaggagtatgagggcaagtggctg
cttttcgatgattctgaagtgaaagtgacggaggaaaaagactttttgaattctctttcg
cctgcgacatcttccacgtccactccttacttactgttttataagaaaattatagagtga

DBGET integrated database retrieval system