KEGG   Monodelphis domestica (opossum): 100031767Help
Entry
100031767         CDS       T01031                                 

Gene name
THBS1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Rap1 signaling pathway
p53 signaling pathway
Phagosome
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100031767 (THBS1)
   04350 TGF-beta signaling pathway
    100031767 (THBS1)
   04151 PI3K-Akt signaling pathway
    100031767 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100031767 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100031767 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    100031767 (THBS1)
  Cellular commiunity
   04510 Focal adhesion
    100031767 (THBS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100031767 (THBS1)
   05205 Proteoglycans in cancer
    100031767 (THBS1)
   05219 Bladder cancer
    100031767 (THBS1)
  Infectious diseases
   05144 Malaria
    100031767 (THBS1)
Heparan sulfate/heparin binding proteins [BR:mdo00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100031767 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 1172 aa AA seqDB search
MGLAWGLVLLLLLKVCGTNRISESGGDNSVFDLFDLPGAAHKGSGRRLVKGPDSSSPAYR
IEDANRIPAMPADKFQDLVDAIRAERGFIFLASLRQMKKTRGTLLTVEYKDHSGHIFSLV
SNGKAGTLDLSISVQGKQQVVSVEEALLATGQWKSILLFVQEDRAQLYVGCEKMENAELD
APIESIFTRDLAGKARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNHII
TLDNPVNGSSPAIRTNYIGHKTKDLQAICGFSCDELANMFLELKGLRTIVTTLQDNIRKV
TEENELLSIAVQKPWSDPGCSYNGIKYNNNDMWTIDSCTECYCQNSVTMCKKVSCPLMPC
SNATIPDGECCPRCWPSDSADDSWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSV
QTRTCHIRECDKRFKQDGGWSHWSPWSSCSVTCGSGEITRIRLCNSPSPQMNGKPCEGEA
RETKACQRDACPINGGWGPWSPWDICSVTCGGGLQKRSRLCNNPKPQFGGKDCVGDATGS
QLCNKQDCPIDGCLSNPCFAGAKCTSYADGSWTCGACPAGYTGNGIQCKDVDECQEVPDA
CFNHNGVHRCENTDPGYNCLPCPPRFTGSQPFGRGVEHATANKQVCKPRNPCTDGTHDCN
KNAKCNYLGHYSDPMFRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNC
PNLPNSGQEDYDKDGIGDACDNDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCP
YNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPL
EHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNMDNCPYVPNANQADHDKDGKGDACDHDD
DNDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVAISETDFR
RFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAIGFDEFNAVDFSGTFFINTER
DDDYAGFVFGYQSSSRFYVVMWKQLTQSYWDSSPTIAQGYAGLSVKVVNSTTGPGEHLRN
ALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPI
YDKTYAGGRLGMFVFSQEMVFFSDLKYECRDS
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctgggggctcgtcctcttactgctgttgaaagtgtgcggcaccaacagg
atctcagaatctggaggcgacaacagtgtgtttgacctctttgatctccctggagctgcc
cacaagggctctgggcgccgtctggtgaaaggtcctgattcctccagcccagcttaccga
atcgaagatgccaatcgtatccctgccatgccagctgacaagttccaagacctggtggat
gcaatccgggcagaaaggggctttatcttcctggcctccctgaggcagatgaaaaagacc
aggggcaccttgctgacagtggagtacaaggatcactccggccatatctttagtctagtt
tctaatggcaaagcaggcactctggacctgagcatttcagtacaggggaagcagcaagtg
gtatcagtggaagaagctctcttggccacaggccaatggaagagtatcctcctgtttgtg
caagaggacagagcccagttgtacgtaggctgcgaaaagatggagaatgctgaactggat
gcccccattgaaagcatcttcaccagggacctggctggcaaggccagactccgagtggcc
aagggagatgttaatgataactttcagggggtgcttcaaaatgtgagatttgtctttgga
accaccccagaggatatcctgaggaataaaggctgttccagctccaccaatcacattatc
acacttgacaatccagtaaatggttccagccctgccatccgcaccaactacattggccac
aagaccaaggatctgcaggcaatctgtggcttctcctgcgatgagctggccaacatgttc
ctggagcttaagggactccggaccatagtgaccacactgcaagacaacatccgcaaggtg
actgaagaaaatgaactactgtccattgcagtgcagaagccttggtcggatcctggctgc
agttacaatggaataaaatataacaacaatgacatgtggactattgatagctgcaccgaa
tgttattgccagaactctgtgaccatgtgcaaaaaagtgtcctgcccccttatgccctgt
tccaatgccacaattcctgatggggagtgctgcccacgttgctggcccagcgattctgct
gatgacagctggtccccatggtctgagtggacgtcctgttcggtgacctgcggcaatggg
atccagcagagaggccgttcctgcgacagcctcaacaaccgctgcgagggctcttccgta
cagacacgaacctgccacatccgcgagtgcgacaagagatttaaacaggatggcggctgg
agccactggtctccgtggtcctcttgctccgtgacctgtggcagtggcgagatcaccagg
attcgcctttgcaactctcccagcccccagatgaatggaaagccgtgtgaaggcgaagca
agagaaaccaaagcctgccagagagacgcctgcccgatcaatggaggctggggcccttgg
tcaccgtgggatatctgttcggtcacctgtggaggaggcctgcaaaaacgtagccggctc
tgcaataatcccaaacctcaatttgggggcaaggattgtgtgggcgatgctaccggaagc
caactctgtaacaagcaggactgtcccatcgatggatgcctgtcaaacccttgctttgcc
ggtgccaagtgtaccagttacgcagatggctcttggacctgtggtgcctgtcccgctggc
tacactggaaatggaatccaatgcaaagatgttgatgagtgtcaagaggtccctgatgcc
tgcttcaaccacaatggggtgcacaggtgtgaaaacactgaccctggctataactgcctg
ccctgtccaccacgtttcacaggatctcagcctttcggacgaggcgtggagcatgccact
gctaacaaacaggtgtgcaagccacgcaatccctgcacagatggaactcatgactgtaat
aagaatgccaaatgcaattacctgggacattacagcgaccccatgttccgttgcgaatgc
aagccaggctatgctggcaatggcatcatctgtggggaggacactgacttggatggctgg
cccaatgaggaccttgtctgtgtcgctaatgcaacttatcactgcaaaaaagataattgc
cctaaccttcccaactctggtcaggaagactatgacaaagatggaattggtgatgcctgt
gataatgatgatgacaatgataaaatcccagatgacagggacaactgtccgttccattat
aacccagcccagtatgactatgaccgagatgatgttggtgatcgctgtgataactgtccc
tataaccacaacccagaccaagcggacaccgataacaatggagaaggagacgcctgcgcg
gcagacattgatggagatggtattcttaacgagagagacaactgccaatatgtatataat
gttgaccaaagggataccgatatggatggcgttggtgaccagtgtgataactgcccacta
gaacataatccagatcagttggactctgactctgaccgtattggtgatacatgtgacaac
aaccaagatattgatgaagatggacaccagaacaatatggataactgcccctatgtgccc
aatgccaatcaagccgatcacgacaaagatggcaaaggggatgcttgtgaccatgatgat
gacaatgatggtatccctgatgacagagacaactgcagactggtgcccaatcctgaccag
aaagattctgatggcgatggacggggagatgcctgcaaagatgactttgaccatgacagt
gtgccagacattgacgacatctgcccagagaacgttgctattagtgagactgatttccga
cgattccagatgatccctctggatcccaaagggacatcccagaatgatcccaactgggtt
gtgcgtcaccagggtaaagagctggtccagactgtgaactgtgatcctggccttgctata
ggctttgatgaatttaatgctgtggacttcagtggcaccttctttatcaatactgagaga
gatgatgactatgctggctttgtgtttggctaccagtccagcagccgcttctatgtggtg
atgtggaaacagctcacccagtcatactgggacagcagtcctaccatagctcagggctac
gcaggtctctctgtcaaagtcgtcaattcaaccacagggcctggggagcacctgaggaat
gcattgtggcacacaggaaacacccccggacaggttcgaaccctgtggcatgaccctcgt
cacattggctggaaagatttcaccgcctacagatggcgtcttagccacagacccaaaact
ggcttcattagagtggttatgtatgaaggaaagaaaatcatggctgactcaggacccatc
tatgacaagacatatgctggtgggagactaggaatgtttgtcttctcccaagaaatggtg
ttcttctctgatctgaaatatgaatgcagagattcctaa

DBGET integrated database retrieval system