KEGG   Monodelphis domestica (opossum): 100031779Help
Entry
100031779         CDS       T01031                                 

Gene name
BCMO1
Definition
(RefSeq) beta-carotene 15,15'-monooxygenase 1
  KO
K00515  
beta-carotene 15,15'-dioxygenase [EC:1.13.11.63]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100031779 (BCMO1)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.63  beta-carotene 15,15'-dioxygenase
     100031779 (BCMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 573 aa AA seqDB search
MEREGEEPKKLSFQSISPSSNLFCHCCYSSGQQQYIIFSAMDMIFGKNKKEQPEPVRAKI
KGELPTWLHGTLLRNGPGMHTIGETTYNHWFDGLALLHSFTIGNGEVHYRSKYLRSDTYN
SNIEANKIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATTE
TNYIRKINPDTLETLEKVDYRDYAAINVATSHPHYDAQGNVLNMGTSIVDKGKTKYLVFK
IPPTIPEKKKKKNNLKHLEVICSIPSRSLLSPSYYHSFGITENYIIFLEQPFKLDILKMA
TAYIRGINWASCITFHEEDKTYIHIIDRRTKRTLLTKFYADPMVVFHHVNAYEEDGHIVF
DVISYKDHSLYQLFYLANLNQDFQQNSKLASIPSLKRFVIPLQVDKDAEMGENLVKLEST
TATARKEKDDQVYCQSEELYEGIELPRINYAYNGKKYRYVYTAEVQWNPIPTKIMKFDVL
TKSSLKWEEEHCWPAEPVFVPAPNAQQEDDGIILSVIVSTDPKKPPFLLILDAKQFTELA
RASVDAEIHLDLHGLFIPSVVSPEEHEDNALMN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagagggtgaagaaccaaaaaagctctctttccagtccatctctccttcctct
aatttattttgtcattgttgttactcatcaggacagcagcaatatattatcttctcagct
atggatatgatctttggcaagaacaagaaggaacaaccagagcctgtaagagccaaaatc
aaaggtgagctgccaacttggcttcatgggactcttctacgaaatggccctggcatgcac
acaattggggagactacatataatcattggtttgatggtttggccttattacatagcttc
accattggaaacggtgaagttcattaccgaagtaaatacctccgaagtgacacctacaat
tccaatattgaagccaacaagattgtggtgtcagagtttggaactatggcttatccagat
ccctgcaaaaatatattttccaaagctttttcctacttgtctcatactattccggacttc
accgataactgcctaatcaacatcatgaaatgtggggaggacttctatgctactacagag
acgaattatattaggaaaatcaacccagacactctggagaccctggagaaggttgattac
cgtgattatgcagccataaatgtggcaacttctcatcctcactatgatgctcaagggaat
gtcctcaacatgggtacatccatagttgacaagggaaaaacaaaatatctggtgtttaaa
atacctcccacgataccagagaagaaaaagaagaaaaacaacttaaaacacctggaagtc
atctgttccatcccgtcccgctctcttctcagtccaagctactaccacagttttggaatt
actgaaaactacataatttttctagagcagccctttaagctggatattctaaagatggcc
actgcctatatccgaggtataaattgggcttcctgcattaccttccatgaagaagacaag
acttacattcacatcattgaccgaaggacaaaacggaccctgctgaccaagttttatgct
gatcctatggttgtcttccatcatgtaaatgcctatgaagaagatggccatattgtgttt
gatgtcatttcctataaggaccacagtctttatcagctcttctacttggcaaacttgaat
caagactttcagcagaactctaaacttgcttccataccatccctcaagagatttgtcatt
cctcttcaggtggacaaggatgcagaaatgggtgagaatttagtcaaacttgaatcaaca
acagcaactgctcggaaggaaaaagatgaccaagtatactgccaatcagaagagctatat
gaaggaatcgagctgcctcgtattaattatgcttataatgggaaaaaatacagatatgtt
tatacagcagaggtgcagtggaatccaataccaacaaagataatgaaatttgatgttctg
acaaagtcatcattaaaatgggaagaggagcattgttggcctgctgagcctgtgtttgtg
cctgcacctaatgcacaacaagaagatgatggtattatattgtcagtgattgtctccact
gatcccaagaaaccaccctttttgctcatactggatgcaaaacaatttacagaattggct
cgggcatcagttgatgcagagatacacctggatctacatgggctattcattccctctgtg
gtttctcctgaagaacacgaagataatgcacttatgaactaa

DBGET integrated database retrieval system