KEGG   Monodelphis domestica (opossum): 100031897Help
Entry
100031897         CDS       T01031                                 

Gene name
TGFBR2
Definition
transforming growth factor, beta receptor II (70/80kDa)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100031897 (TGFBR2)
   04350 TGF-beta signaling pathway
    100031897 (TGFBR2)
   04390 Hippo signaling pathway
    100031897 (TGFBR2)
   04068 FoxO signaling pathway
    100031897 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100031897 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100031897 (TGFBR2)
  Cellular commiunity
   04520 Adherens junction
    100031897 (TGFBR2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    100031897 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100031897 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    100031897 (TGFBR2)
   05210 Colorectal cancer
    100031897 (TGFBR2)
   05212 Pancreatic cancer
    100031897 (TGFBR2)
   05220 Chronic myeloid leukemia
    100031897 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    100031897 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    100031897 (TGFBR2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100031897 (TGFBR2)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   100031897 (TGFBR2)
Enzyme-linked receptors [BR:mdo01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   100031897 (TGFBR2)
Cytokine receptors [BR:mdo04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100031897 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 564 aa AA seqDB search
MSRALLWSPGLLLLFLWTRNASTIPPHVQKIVDGVPVTEENGAIKSSLLCKFCDIQPSNC
TNDRSCPSYCGITSICEKAHEICVAVWRKNDKNITIETLCHDPSLEVHGFPLEDSNSDKC
IMREKKVPGETFFMCSCRKEECNDILFFSEDVLDNFDLMAIIFKVTVISLLPPLGIAIAV
IIIFYCYRVHRRRKLSTAWETSKPGKPDYSEGCAMMLDDDRSDISSTCANNLNHNTELLP
IELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKEIFSDINLKHEN
ILQFLTAEERKMDLGKQYWLITAFHARGNLQEYLTRHVISWEDLWKLGSSLARGIAHLHS
DHTPCGRPKTAIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTAR
YMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTSRCNEIGEVKEYEPPFGSKVREHPC
VESMKDNVLRDRGRPEIPNTWLSHRGIQMVCETLAECWDHDPEARLTAQCVAERFDQLGD
LDRLSGRSCSEEKIPEDCSLSPTK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgggctctcctgtggagcccggggctactgctcctcttcctgtggacgcgcaat
gccagcaccatccctccccacgtccagaagatcgttgatggagttccagtcacggaggaa
aatggtgccatcaagtcttcactcctttgcaagttttgtgatatccaaccctccaactgc
accaatgataggagctgcccaagttactgtggcatcacatcaatctgtgaaaaggcacac
gaaatctgcgtagctgtgtggaggaagaatgataaaaatattaccatagaaacactctgt
catgatcctagccttgaggtccatggttttcccctggaggattctaattctgataaatgc
ataatgcgggaaaaaaaggtccctggtgagaccttcttcatgtgttcctgtaggaaggag
gaatgcaatgacatcttgttcttctcagaagatgtccttgacaatttcgacctcatggcc
atcatcttcaaagtgactgtcatcagcctccttcccccactgggcatcgccattgccgtg
atcatcatcttctactgttaccgagtccaccgccggagaaagctgagcaccgcctgggag
acgagcaagccagggaagccagactacagcgagggctgtgccatgatgttggatgacgac
cgctcggacatcagctccacgtgcgccaacaacctcaaccacaacaccgagctcctgccc
atcgagctggacacgctggtggggaagggtcgcttcgctgaggtctacaaggccaagctg
aaacagaacacgtccgagcagttcgagacggtggccgtcaagatcttcccctacgaggaa
tacgcctcctggaagacggagaaggaaatcttctccgacatcaacctgaaacacgagaac
atcctccagttcttgacggcggaggagcggaagatggacctggggaagcagtactggctc
atcaccgccttccacgccaggggcaacctgcaagagtatctcactcggcatgtcatcagc
tgggaagacctgtggaagctgggcagctccctggcccggggcattgcccatctccatagc
gaccacacgccctgtgggagacccaaaacggccatcgtgcaccgagacctgaagagctcc
aacatcctggtgaagaacgacctgacctgctgcctctgtgacttcgggctctccctgagg
ttggacccgaccctctctgtggatgacttggctaacagcgggcaggttgggacagcaaga
tatatggctcccgaagttttggaatccagaatgaacttggagaatatggagtctttcaag
caaacagatgtatattccatggcccttgttctctgggaaatgacatctcgctgcaatgag
ataggagaggtcaaggaatatgagccgccatttggttccaaggtgagagagcacccctgc
gttgaaagcatgaaggacaacgtgctgagagaccgaggacggcccgagatcccaaacact
tggctcagtcaccgaggtatccagatggtctgtgagactctggctgaatgctgggaccac
gatccagaggcccgactgaccgctcagtgcgtggccgagcgtttcgaccaactgggggac
ctggaccggctgtcggggagaagctgttcggaggaaaagatccctgaggactgttctctg
agccccaccaaataa

DBGET integrated database retrieval system