KEGG   Monodelphis domestica (opossum): 100031949Help
Entry
100031949         CDS       T01031                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mdo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 518 aa AA seqDB search
MRSAVKLVYVSPSNLIYKVVCLPKEENDRLMTMQLLLAEKCHATIISWGCSVESGRVAEE
RASVCYGGGFDCSGAPGVLLNMIGLRLGLISCAFFLGVNGLYSSSDDVIELTPSSFNREV
IQSNSLWLIEFYAPWCGHCQRLAPEWKKAATALKDIVKVGAVDADKHQSLGGQYGVQGFP
TIKIFGSNKNRPEDYQGGRTGEAIIDAALSSLRQLVKERLGGRSGGYSSSRNEGSGKKDV
IELTDDTFDKNVLDSDDVWLVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDA
TVNQALTSRYGIGGFPTIKIFQKGEPPVDYSGGRTRSDIVSHALDLFSDNAPPPELLEIV
DEAVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLAEKYKKKLWGWLWTEAGAQ
YELENALGIGGFGYPAMAAINTRKMKFALLKGSFSEQGINEFLRDLSVGRGSTAPVGGGV
FPKISTVAPWDGKDGELPIEDDIDLSDVELDDLGKDEL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtgccgtgaaactagtttatgtttcaccatcaaatctaatctacaaggttgta
tgcctcccaaaagaagagaatgacaggctcatgacaatgcaattgctacttgcagaaaag
tgccatgcaaccatcatcagttgggggtgctcagtagagagcgggcgggtggctgaggag
cgggcgagcgtgtgctacggtggcggctttgactgcagtggggcccccggggtgctcctc
aacatgatcggcctaaggcttggattgataagctgtgccttctttctgggtgtaaatggt
ttatattcctctagtgatgatgtgatagaattgactccttccagtttcaaccgtgaagtt
attcagagtaacagtttgtggctcatagaattctatgctccatggtgtggtcattgccaa
aggttagcaccagaatggaagaaagcagcaacagcattaaaagatatagtgaaagttggt
gcagttgatgcagataaacatcagtccttaggtggacagtatggagtccaaggatttccc
actattaagatatttggatccaacaaaaatagaccagaagattaccagggtggtagaact
ggtgaagctattatagatgctgcccttagttctttacgacaactggtaaaggaacgcctt
ggtggaagaagtggtggatatagttctagtcgaaatgaaggttcaggcaagaaggatgtg
attgaactaacagacgacacttttgataaaaatgtacttgacagtgatgatgtttggttg
gtggagttttatgctccttggtgtgggcattgcaaaaacttagaacctgaatgggcagct
gcagccacagaagtaaaggagcagacaaaaggaaaagtgaagctagctgctgtagatgct
acagtaaatcaggcattgactagccgatatgggattggaggatttcccacaatcaagatt
ttccaaaaaggagaaccacctgtggattatagtggtgggaggacaagatctgacatagtt
tcccatgctctagatttattttctgataatgctccaccacctgagctccttgagattgtt
gatgaagcagtggcaaagaaaacttgtgaagaacaccagctctgtgtagttgctgtatta
cctcatattcttgatactggagcagcaggtagaaattcttacttggaagttctgctaaaa
ttagcagagaaatacaaaaagaaattgtggggatggctgtggacagaagctggagctcag
tatgagcttgagaatgcactggggataggaggttttggataccctgcaatggcagctatc
aatacacggaagatgaaatttgctcttttgaaaggatctttcagtgagcaaggcatcaat
gagtttctcagagatttatctgttggtcgtggctccacggcaccagtaggtggtggtgtt
ttccctaaaataagcacagtagccccttgggatggcaaagatggtgagcttcccattgaa
gatgatattgacctcagcgatgtagaacttgacgacttaggaaaagatgagttgtga

DBGET integrated database retrieval system