KEGG   Monodelphis domestica (opossum): 100031975Help
Entry
100031975         CDS       T01031                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mdo00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mdo00591]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:mdo04913]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mdo04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:mdo04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 504 aa AA seqDB search
MQLPLGNVLPSLQTLLLFSAILLILASYVQRRRRRQQLKYPPGPLRLPIFGNVFQIDTTK
AHVSVQEFVRKFGNIFSMELFGVPMMTVTGLPLIKEVLINQGQVFVDRPQFPLQTYTFKS
VGLLMSNGQEWKDQRRFTLMTLRNFGLGKKTLELRIQEEATYLIEAIREEKGQPFDPHFQ
INNAVSNIICSVTFGNRFEYHDSQFRELLKSLDQVSVLQASWECQFFNIIPWIMKFLPGA
HKKLFREFKKLESFVVHVIKQHKEDQNSEEARDFIDAYLKELSKGNNSSSFNEDNLVSCT
LDLFFAGTETTSTTLRWALLYMALYPEIQGKIQAEIDRVIGHSRQPTMADRENMPYTYAA
IHEVQRMGNIIPLNAARVATVDTTLAGYHVPKGTWLLTNLTALHRDPKEWATPETFNPEH
FLENGEFKKRESFLPFSAGKRVCLGEQLARAELFIFFTCLLQRFTFQAPPDTQLSLDFRT
GMTVSPAPYKICAIPRETEPKLSL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcagctccctctaggaaacgtgctcccttccctgcagaccctcctcctcttctctgcc
attctcctgatcctggccagttatgtgcagaggaggaggaggaggcagcagcttaaatac
cccccggggcctcttcggctgcccatatttggcaacgtcttccagatagacaccacaaaa
gcccatgtcagcgtccaggagtttgtcaggaaatttgggaacattttctccatggaacta
ttcggtgttcccatgatgactgtaactggattgccactaataaaggaagtcctaatcaac
caaggccaggtgtttgttgatcgtccccaatttcctttgcagacttacacctttaaatca
gttggcttactcatgtctaatggtcaagaatggaaagaccaaagaagatttaccttaatg
acactaaggaattttggcttgggaaagaagacccttgaacttaggatccaggaagaagct
acatacctcattgaggcaatcagagaagaaaaaggacaaccctttgacccccactttcag
atcaacaatgctgtttccaacatcatctgttctgtcacttttgggaatcgttttgaatac
catgattctcagtttcgggagctactgaagagcttggatcaagtctcggtgcttcaagcc
agttgggagtgtcagttcttcaatataattccttggataatgaaattcttgccaggagct
cacaaaaagctctttagagaattcaagaaactagaatcttttgtagtccatgtgatcaaa
caacataaggaagatcaaaactcagaggaagcccgggacttcattgatgcttatctgaag
gagctgtccaagggtaacaatagctctagttttaatgaagacaatttagtctcatgtaca
ctggatctcttctttgctggaacagagacaacttcgaccactctgcggtgggccctgctg
tatatggccctttatccagagatccaaggtaaaatacaagctgagattgacagggtgatt
ggccactcccggcagcccaccatggctgatagagaaaatatgccctatacttatgcagcc
atccatgaagtccagagaatgggcaatatcattcctctcaatgcagccagggtggccaca
gttgataccacactggcaggataccatgtgccaaaggggacctggctgctgaccaatctg
actgctttgcacagggaccccaaggagtgggctacccctgaaaccttcaacccagaacat
tttctggagaatggtgaatttaagaaaagagagtcctttctgcctttctcagcagggaag
agggtctgcctgggagaacagctggctcgggctgagctcttcattttcttcacttgcctg
cttcagagattcacattccaggctcccccagacacccagctgagtctggacttccgaact
ggcatgaccgtctctcctgccccctacaaaatctgtgccattcctcgggagacagagccc
aagcttagcttgtag

DBGET integrated database retrieval system