KEGG   Monodelphis domestica (opossum): 100031975Help
Entry
100031975         CDS       T01031                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100031975
   00591 Linoleic acid metabolism
    100031975
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100031975
  Nervous system
   04726 Serotonergic synapse
    100031975
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100031975
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100031975
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP2 family
   100031975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 504 aa AA seqDB search
MQLPLGNVLPSLQTLLLFSAILLILASYVQRRRRRQQLKYPPGPLRLPIFGNVFQIDTTK
AHVSVQEFVRKFGNIFSMELFGVPMMTVTGLPLIKEVLINQGQVFVDRPQFPLQTYTFKS
VGLLMSNGQEWKDQRRFTLMTLRNFGLGKKTLELRIQEEATYLIEAIREEKGQPFDPHFQ
INNAVSNIICSVTFGNRFEYHDSQFRELLKSLDQVSVLQASWECQFFNIIPWIMKFLPGA
HKKLFREFKKLESFVVHVIKQHKEDQNSEEARDFIDAYLKELSKGNNSSSFNEDNLVSCT
LDLFFAGTETTSTTLRWALLYMALYPEIQGKIQAEIDRVIGHSRQPTMADRENMPYTYAA
IHEVQRMGNIIPLNAARVATVDTTLAGYHVPKGTWLLTNLTALHRDPKEWATPETFNPEH
FLENGEFKKRESFLPFSAGKRVCLGEQLARAELFIFFTCLLQRFTFQAPPDTQLSLDFRT
GMTVSPAPYKICAIPRETEPKLSL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcagctccctctaggaaacgtgctcccttccctgcagaccctcctcctcttctctgcc
attctcctgatcctggccagttatgtgcagaggaggaggaggaggcagcagcttaaatac
cccccggggcctcttcggctgcccatatttggcaacgtcttccagatagacaccacaaaa
gcccatgtcagcgtccaggagtttgtcaggaaatttgggaacattttctccatggaacta
ttcggtgttcccatgatgactgtaactggattgccactaataaaggaagtcctaatcaac
caaggccaggtgtttgttgatcgtccccaatttcctttgcagacttacacctttaaatca
gttggcttactcatgtctaatggtcaagaatggaaagaccaaagaagatttaccttaatg
acactaaggaattttggcttgggaaagaagacccttgaacttaggatccaggaagaagct
acatacctcattgaggcaatcagagaagaaaaaggacaaccctttgacccccactttcag
atcaacaatgctgtttccaacatcatctgttctgtcacttttgggaatcgttttgaatac
catgattctcagtttcgggagctactgaagagcttggatcaagtctcggtgcttcaagcc
agttgggagtgtcagttcttcaatataattccttggataatgaaattcttgccaggagct
cacaaaaagctctttagagaattcaagaaactagaatcttttgtagtccatgtgatcaaa
caacataaggaagatcaaaactcagaggaagcccgggacttcattgatgcttatctgaag
gagctgtccaagggtaacaatagctctagttttaatgaagacaatttagtctcatgtaca
ctggatctcttctttgctggaacagagacaacttcgaccactctgcggtgggccctgctg
tatatggccctttatccagagatccaaggtaaaatacaagctgagattgacagggtgatt
ggccactcccggcagcccaccatggctgatagagaaaatatgccctatacttatgcagcc
atccatgaagtccagagaatgggcaatatcattcctctcaatgcagccagggtggccaca
gttgataccacactggcaggataccatgtgccaaaggggacctggctgctgaccaatctg
actgctttgcacagggaccccaaggagtgggctacccctgaaaccttcaacccagaacat
tttctggagaatggtgaatttaagaaaagagagtcctttctgcctttctcagcagggaag
agggtctgcctgggagaacagctggctcgggctgagctcttcattttcttcacttgcctg
cttcagagattcacattccaggctcccccagacacccagctgagtctggacttccgaact
ggcatgaccgtctctcctgccccctacaaaatctgtgccattcctcgggagacagagccc
aagcttagcttgtag

DBGET integrated database retrieval system