KEGG   Monodelphis domestica (opossum): 100032072Help
Entry
100032072         CDS       T01031                                 

Gene name
PCMT1
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100032072 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 294 aa AA seqDB search
MSGARSGPRGSSRSSSGGSSSSGGRAGDADVDGAVSVGEVVEFLAKLLGIAAALKLIFYL
FQACLAMAWKSGGANHSELIQNLRKNGIIKSEKVFQVMLATDRAHYAKCNPYMDSPQSIG
FQATISAPHMHAYALELLFDQLHDGAKALDVGSGSGILTACFARMVGATGKVIGIDHIKE
LVDDSISNVKKDDPAFLSSGRVKLVVGDGRLGYTEEAPYDAIHVGAAAPVVPQALIDQLK
PGGRLILPVGPAGGNQMLEQYDKLEDGSVKMKPLMGVIYVPLTDKEKQWSRDEL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggagcgcgcagcggccctaggggtagtagcaggagcagcagcggcggcagcagc
agcagcggcggccgcgccggggacgcggacgtagacggggcggtgtcggtgggggaggtg
gtcgagttcctcgcgaagctgctgggcatcgccgccgcgctgaagctgattttctacttg
ttccaggcgtgcctcgcgatggcctggaagtccggcggggccaatcactcggagctcatc
caaaatctccgcaaaaatggaataatcaagtcagagaaagttttccaagtaatgctggcc
acagatcgtgctcactatgcaaaatgtaatccctacatggattctccacaatcaataggt
ttccaagcaacaatcagtgctccacacatgcatgcatatgctctagaacttctatttgat
cagttgcatgatggagccaaagctcttgatgttgggtctggaagtggaattcttactgct
tgctttgcccgcatggttggtgctactggaaaagtcataggaattgatcatatcaaggag
ttagtagatgactcaataagtaacgtcaaaaaggatgatccagcatttttgtcttcagga
cgagtgaaactagttgtgggagatggaagattgggatacacagaagaagctccctatgat
gctatccatgtaggagctgcagctccagtagtgccccaagcactaatagatcaattgaag
cctggtggaagattgattttaccagttggtcctgcaggtggaaaccagatgctggaacag
tatgacaagctagaagatggcagcgtcaaaatgaaaccactgatgggagtgatatacgtg
cctttaacagataaagagaagcagtggtccagggatgaactgtaa

DBGET integrated database retrieval system