KEGG   Monodelphis domestica (opossum): 100032119Help
Entry
100032119         CDS       T01031                                 

Gene name
BDH1
Definition
3-hydroxybutyrate dehydrogenase, type 1
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100032119 (BDH1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100032119 (BDH1)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100032119 (BDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 340 aa AA seqDB search
MLTARFSRSLVHLSRNFLSFQNIGRPGQELFDPQATPAGQRSSSTQVTEIGNRAVLITGC
DSGFGFTTAKDLHELGFRVFAGCLFKDKGGKGVEELDSMKSERMQTIQLDVCQSAEVEKA
VKTIQESLEDPEKGLWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTIRTTKACLPLI
RRAKGRVVNISSMLGRMSSPSRSPYCITKYGVEAFSDCLRYEMYPLGVRVCVVEPGNFIA
ATSLYSPERIRAIANKMWNELPEVVRQDYGREYFEESVSKMERYCTSGSTDTSAVIRAVR
HALTSARPHTRYHPMDYYWWLRMQIMTHTPAAVSDMLYIH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctgactgctcgcttctccaggtcgctggtgcatctttccaggaacttcctcagtttc
cagaacatcggaaggcctggccaggagctcttcgatccacaggccaccccggctggccaa
aggtcctcttctacccaagtaaccgagatcggcaatagagccgtgctcatcacgggctgc
gactccggcttcggcttcaccacggccaaagacctgcacgagctgggcttccgggtgttc
gccggctgccttttcaaggacaagggggggaaaggtgtcgaggagctggacagcatgaag
agcgagcgcatgcagaccatccagctggacgtctgccagagtgctgaggtagaaaaggcc
gtgaagacgatccaggagagcctggaggaccccgagaaagggctctgggggctggtgaac
aacgcgggcatctccaccttcggcgaggtggagttcaccagcatggagacctacaaggag
gttgccgaagtgaatctgtgggggaccatccggacgaccaaggcttgcctcccgctcatc
cggagggccaaaggccgggtggtgaacatcagcagcatgctgggcaggatgagcagccct
tcgcgctccccgtactgcatcaccaagtatggcgtggaggccttctccgactgcctgcgc
tacgagatgtacccgctgggcgtcagggtgtgcgtggtggagcccggaaacttcatcgcg
gccaccagcctgtacagccccgagcgcatccgggccatcgccaacaagatgtggaacgag
ctgcccgaggtggtgcgccaggactacggccgcgagtacttcgaggagagcgtctccaag
atggagcgctactgcaccagcggctccaccgacacgagcgccgtcatccgggccgtgcgg
cacgcgctgacctccgccaggccccacacccgctaccaccccatggactactactggtgg
ctgcggatgcagatcatgacccacaccccggcggccgtctcggacatgctctacatccac
tga

DBGET integrated database retrieval system