KEGG   Monodelphis domestica (opossum): 100032176Help
Entry
100032176         CDS       T01031                                 

Gene name
USP28
Definition
ubiquitin specific peptidase 28
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1074 aa AA seqDB search
MGAFEELWAWEHPRVMALLVQSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLL
TDERVKEPSQDTIAAEPSEGEGSAANKVVPTKVIDPTHDNKDDLQAAIALSLLESPKIQT
DGRDHNRTHEATAIENKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQ
SLFQLSEFRRLVLGYSLPQNILENCRSHTEKRNIVFMQELQYLFALMMGSNRKFVDPSAA
LDLLKGAFRSADEQQQDVSEFTHKLLDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLT
EGVHEGKTFCNNETFGQYPLQVNGYRNLDECLEGAMVEGEIEMLPPDHSVKYGQERWFTK
LPPVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYSSKELIRTKREHIRKLKEE
VKVLQQKLERYVKYGSGPARFPLPDMLQYVLEFASTKPATEAPPSVHCPISDLTTKKSIR
AEEYSCQVEVPLSSLEKDNLLQTDLINKPFTSSRHSVKMPEHPAPRTITEEEMNFVKTCL
QRWRSEIEQDIQDLKNCIANTTQTIEQMYSDPLLHQVPYRLHAVLVHEGQANAGHYWAYI
YNRPRNIWLKYNDISVTESSWEELERDSYGGLRNVSAYCLMYINDKLPHFTSEAAASEPD
QMLKEVEALSVELKHYIQEDNWRFEQEVEEWEEQQSCKIPQIESSTTSESQDFSDTSQEP
SLTPSHGVRCLSSEHAVIAKDQTAQAIANTAYAYEKSGVEAALSEVMLSPAMQGVILAIA
KARQAFDRDGSEAGLIKAFHEEYSRLYQLAKETPTPHNDPRLQHVLVYFFQNEAPKRVVE
RTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLFRKVSVYLL
TGLELYQNGKCHEALSYLVYAYQSNAALLMKGPSRGVEESVIALYRRKCLLKLNSMAASL
FETNEELNVTEGINVMNELIIPCIHLIINNDISKDDLAAIEIMRNHWCSYLGQDIAENLQ
LRLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGASAVTVK
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgggggccttcgaggagctctgggcctgggagcaccctagagtgatggctctgctggtg
caaagctgccaaatgcttttaaatcaactgagagaaatcactggaatccaggacccttcc
tttcttcatgaagctttgaaggcaagtaatggtgatataacccaagcagtaagccttctt
actgatgaaagggttaaagaaccgagccaagacaccattgctgcagaaccatcagaagga
gaaggaagtgctgccaacaaagtagtaccaacaaaagtaattgatccaacacatgataat
aaagatgatctacaggcagccattgctttgagtctactagagtcaccaaaaattcaaact
gatggaagggatcataacaggactcatgaagcaactgctattgaaaataaacgctcaaag
aggaaacgttgtgaagtctggggagaaaatccgaaccccaatgattggaggagagtggat
ggttggccagttggacttaaaaatgttggcaatacctgttggtttagtgctgtcatacag
tctctctttcaactatctgaatttcgaagacttgttcttggctatagtcttccacaaaat
atacttgaaaattgccgaagccacacagaaaaaagaaatattgtatttatgcaggagctg
cagtatctgtttgctttaatgatgggatcaaatcgtaaatttgtagacccttcagctgcc
ctggatctcttaaagggagcattccgatcagcagatgaacaacagcaagatgtgagtgaa
ttcacccacaagctcctagattggctggaggatgctttccagcttgccgttaatgttaac
agtcccaggaacaaatctgaaaacccaatggtgcagcttttctatggcactttcctgact
gaaggggttcatgaaggtaagaccttttgcaacaatgagacttttggccagtaccccctt
caggtaaatggttatcggaacttagatgaatgtttggaaggagccatggtagagggggag
attgagatgcttcctcctgatcattcagtgaaatatggacaagagcgatggtttacaaag
ctacctccagtactgacctttgaactctccagatttgagttcaatcaatccttaggtcaa
ccagagaaaattcacaataagctggaatttcctcagattatttatatggataggtatatg
tatagcagcaaagagcttattcgaactaagagagaacacattcggaagttgaaagaggaa
gttaaagttcttcagcaaaagttggaaaggtatgtgaagtacggctctggccctgctcgg
ttccccctccctgacatgttgcagtatgtccttgagtttgccagcaccaagcctgccaca
gaagcgcctccctctgtccactgccctatttctgacctgacaaccaagaagagtattaga
gcagaagaatattcttgccaagttgaagttcctctgtcttctttggaaaaagataattta
ctacaaactgatctgataaataagccatttacatcttcccgacattcagtgaaaatgcct
gagcacccagctccacgaacaatcactgaggaggaaatgaactttgttaagacctgtctt
cagaggtggaggagtgagattgaacaagatatacaagacctaaaaaattgtattgcaaat
accacacaaacaattgagcagatgtactctgatccccttcttcatcaggtgccttatcgc
ttgcatgcagttctggttcatgaagggcaagcaaatgctggacattactgggcctatatc
tataatcgaccccgaaacatatggctcaaatacaatgacatctctgtaactgagtcttcc
tgggaagaacttgagagggactcctatggaggtctgagaaatgttagtgcttactgcctg
atgtacattaatgacaagctaccccacttcacttcagaagcggcagcatctgagccagac
cagatgctgaaagaggtggaagccttgtctgtagaacttaagcattatatccaagaagat
aactggagatttgagcaggaagtagaggaatgggaggagcaacagtcctgcaaaatccct
cagattgaatcctctaccacctcggaatcacaggatttctcagacacttcgcaagagcca
tccttgaccccttcccatggtgttcgatgtttatcatctgagcatgctgtgattgcaaag
gaccagacagcccaggctattgccaacacagcatatgcctatgaaaaaagtggtgtggaa
gctgctctatcagaggtgatgctgagccccgccatgcagggggtcatcctggccatagct
aaagcccgtcaggcctttgatcgagatgggtctgaagcagggcttattaaggcattccat
gaagagtactccaggctatatcagctggccaaagagacccctacacctcacaatgaccct
cggctccaacatgtccttgtgtattttttccaaaatgaagctccaaaacgagtggtggag
cggactctcttggaacagtttgccgataaaaacctcagctatgatgaaagatcaattagc
atcatgaaagtggctcaagctaaactaaaggagattggcccagacgacatgaatatggaa
gaatacaagaaatggcatgaagattacagtttgtttcgaaaagtgtctgtgtatcttctg
acaggcctggagctctatcagaatggaaagtgtcatgaagcactttcctacctggtgtat
gcatatcagagtaatgcagccctgctaatgaagggacctagcagaggagtggaagaatca
gtgattgctttatatcgaagaaaatgccttctgaaactgaatagtatggcagcttctctg
tttgaaaccaatgaggaactcaatgtgactgagggcatcaatgtcatgaatgagttgatc
attccctgcattcatctcatcataaataatgacatctcaaaggatgacttggctgctatt
gagatcatgaggaaccactggtgctcttaccttgggcaggatattgctgaaaacctccag
ctgagactcggggagtttctccccaggcttttagacccctctgcggaaatcatagtcttg
aaagagcctccaactatccgccccaactccccctatgatctttgtagcagatttgctgca
gtcatggaatcgatccagggggcttcagctgtgacggtgaagtaa

DBGET integrated database retrieval system