KEGG   Monodelphis domestica (opossum): 100032278Help
Entry
100032278         CDS       T01031                                 

Gene name
DLAT
Definition
dihydrolipoamide S-acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mdo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mdo00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mdo00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mdo00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 643 aa AA seqDB search
MWRVCARQARCAAPRTGFGSPAAAPREAPGGPVPAAPPSLARSSHSRARALRAWGPCSAS
GAVPRVPFLLLQVLGAPGRRWYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKINEGDL
IAEVETDKATVGFESLEECYLAKIIVPEGTRDVPVGAVICITVEKMEDVDAFKNYTLDST
AATTPQVSTAPPSAPVASSPSLQAPGSSYPPHLQVLLPALSPTMTMGTVQRWEKKVGEKL
NEGDLLAEIETDKATIGFEVQEEGYLAKILIPEGTRDVPLGTPLCIIVEKEADIPAFADY
RQTGVTDIKPQATPSTSPPIAAVPPTPLSTPTAPSASHPAMPTGAKGRVFASPLAKKLAA
EKGIDLKQVRGTGPDGRITKKDIESFVPSKATPALPPTAAMPAPAPGVAAVPTGIFTDIP
ISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLEVRKELNTILAGGSKISVNDFIIKAS
AMACLKVPEANSSWMDTVIRQNHVVDISVAVSTPSGLITPIVFNAHIKGLESIANDVVSL
ATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAVGASENRLVPADNEK
GFDVASMMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPITMIL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgagtgtgtgcacggcaggctcggtgcgcggccccgcggacggggtttgggagc
ccggccgcggccccgagggaagccccgggagggccggtcccagccgcgcccccaagcctg
gcccgttcttcccacagcagggctagagcattgcgggcctggggtccttgctccgcctcc
ggggccgtgccacgggtgcctttcctgctgctgcaggtcttgggggctcctggacgacgc
tggtacagtcttcctccacaccagaaggttcctttgccttctctttcccctacaatgcag
gcagggaccattgcccgctgggagaaaaaggaaggggaaaagatcaatgagggtgacctt
atagctgaagttgaaacagataaagctactgttggatttgagagcctagaagagtgctac
ctggctaaaataattgttcctgaaggtaccagagatgttccagttggagcagtcatctgt
attactgttgaaaaaatggaggatgtggatgcatttaaaaattataccctggattccaca
gcagcaaccactccccaagtttctacagctcctccctctgctcctgtggcttcatcacct
tctctccaggctccagggagctcatatcctcctcatttgcaagtcctgcttcctgccctc
tctcccactatgactatgggcacagttcagaggtgggagaagaaggtgggtgagaaattg
aatgaaggagacttgctggctgagatagaaactgacaaagccacaataggttttgaagta
caagaggaaggatatctggcaaaaattcttatccctgaaggcacgagagatgtccctcta
ggaactccactctgtatcattgtagaaaaagaagcagatattcctgcatttgctgactat
aggcagaccggagtaactgatataaaaccccaagcaacaccatccacctcacccccgatt
gctgctgttcctcctacacccctatctacacccactgcaccttcagcctcccatccagct
atgcctactggtgcaaaaggaagagtatttgcaagtcctcttgcaaagaaattggcagca
gagaaaggaattgaccttaaacaagtgagaggaaccgggccagatggtagaatcaccaag
aaagatatcgaatcttttgtgccttcaaaggctactcctgctcttcctccaacagcggcc
atgcctgcaccagctccaggagtagcagcagttcctactggcatttttacagatatccca
atcagcaatattcgtagagttattgcccagcgtttaatgcagtccaagcaaacaatacct
cattattacctttccatagatgtaaacatgggagaagttttagaagtacggaaagaactc
aacacaatattggcaggaggcagtaaaatttctgtcaatgactttatcattaaagcttca
gctatggcatgtttgaaagtacctgaagcaaattcttcttggatggatacagttataagg
caaaatcatgttgttgatattagtgttgccgtcagtactccttctggactcattacacct
attgtatttaatgcacatataaaaggactggaatccattgctaatgatgtagtttcttta
gcaaccaaagctcgagagggtaaacttcagccacatgaatttcagggtggtacttttacc
atctccaatttaggtatgtttgggattaagaatttctctgccattattaacccacctcag
gcatgtattttggcagttggtgcttcagagaatagactggttccagcagataatgaaaaa
ggatttgatgtagccagcatgatgtctgttacactcagctgtgaccatcgggtcgtggat
ggagcagttggagctcagtggcttgctgagttcaaaaaataccttgaaaagcctatcact
atgatattataa

DBGET integrated database retrieval system