KEGG   Monodelphis domestica (opossum): 100032278Help
Entry
100032278         CDS       T01031                                 

Gene name
DLAT
Definition
(RefSeq) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00020  Citrate cycle (TCA cycle)
mdo00620  Pyruvate metabolism
mdo01100  Metabolic pathways
mdo01200  Carbon metabolism
Module
mdo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100032278 (DLAT)
   00020 Citrate cycle (TCA cycle)
    100032278 (DLAT)
   00620 Pyruvate metabolism
    100032278 (DLAT)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100032278 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 100032278
NCBI-ProteinID: XP_001381327
Ensembl: ENSMODG00000014415
Position
4
AA seq 643 aa AA seqDB search
MWRVCARQARCAAPRTGFGSPAAAPREAPGGPVPAAPPSLARSSHSRARALRAWGPCSAS
GAVPRVPFLLLQVLGAPGRRWYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKINEGDL
IAEVETDKATVGFESLEECYLAKIIVPEGTRDVPVGAVICITVEKMEDVDAFKNYTLDST
AATTPQVSTAPPSAPVASSPSLQAPGSSYPPHLQVLLPALSPTMTMGTVQRWEKKVGEKL
NEGDLLAEIETDKATIGFEVQEEGYLAKILIPEGTRDVPLGTPLCIIVEKEADIPAFADY
RQTGVTDIKPQATPSTSPPIAAVPPTPLSTPTAPSASHPAMPTGAKGRVFASPLAKKLAA
EKGIDLKQVRGTGPDGRITKKDIESFVPSKATPALPPTAAMPAPAPGVAAVPTGIFTDIP
ISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLEVRKELNTILAGGSKISVNDFIIKAS
AMACLKVPEANSSWMDTVIRQNHVVDISVAVSTPSGLITPIVFNAHIKGLESIANDVVSL
ATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAVGASENRLVPADNEK
GFDVASMMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPITMIL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgagtgtgtgcacggcaggctcggtgcgcggccccgcggacggggtttgggagc
ccggccgcggccccgagggaagccccgggagggccggtcccagccgcgcccccaagcctg
gcccgttcttcccacagcagggctagagcattgcgggcctggggtccttgctccgcctcc
ggggccgtgccacgggtgcctttcctgctgctgcaggtcttgggggctcctggacgacgc
tggtacagtcttcctccacaccagaaggttcctttgccttctctttcccctacaatgcag
gcagggaccattgcccgctgggagaaaaaggaaggggaaaagatcaatgagggtgacctt
atagctgaagttgaaacagataaagctactgttggatttgagagcctagaagagtgctac
ctggctaaaataattgttcctgaaggtaccagagatgttccagttggagcagtcatctgt
attactgttgaaaaaatggaggatgtggatgcatttaaaaattataccctggattccaca
gcagcaaccactccccaagtttctacagctcctccctctgctcctgtggcttcatcacct
tctctccaggctccagggagctcatatcctcctcatttgcaagtcctgcttcctgccctc
tctcccactatgactatgggcacagttcagaggtgggagaagaaggtgggtgagaaattg
aatgaaggagacttgctggctgagatagaaactgacaaagccacaataggttttgaagta
caagaggaaggatatctggcaaaaattcttatccctgaaggcacgagagatgtccctcta
ggaactccactctgtatcattgtagaaaaagaagcagatattcctgcatttgctgactat
aggcagaccggagtaactgatataaaaccccaagcaacaccatccacctcacccccgatt
gctgctgttcctcctacacccctatctacacccactgcaccttcagcctcccatccagct
atgcctactggtgcaaaaggaagagtatttgcaagtcctcttgcaaagaaattggcagca
gagaaaggaattgaccttaaacaagtgagaggaaccgggccagatggtagaatcaccaag
aaagatatcgaatcttttgtgccttcaaaggctactcctgctcttcctccaacagcggcc
atgcctgcaccagctccaggagtagcagcagttcctactggcatttttacagatatccca
atcagcaatattcgtagagttattgcccagcgtttaatgcagtccaagcaaacaatacct
cattattacctttccatagatgtaaacatgggagaagttttagaagtacggaaagaactc
aacacaatattggcaggaggcagtaaaatttctgtcaatgactttatcattaaagcttca
gctatggcatgtttgaaagtacctgaagcaaattcttcttggatggatacagttataagg
caaaatcatgttgttgatattagtgttgccgtcagtactccttctggactcattacacct
attgtatttaatgcacatataaaaggactggaatccattgctaatgatgtagtttcttta
gcaaccaaagctcgagagggtaaacttcagccacatgaatttcagggtggtacttttacc
atctccaatttaggtatgtttgggattaagaatttctctgccattattaacccacctcag
gcatgtattttggcagttggtgcttcagagaatagactggttccagcagataatgaaaaa
ggatttgatgtagccagcatgatgtctgttacactcagctgtgaccatcgggtcgtggat
ggagcagttggagctcagtggcttgctgagttcaaaaaataccttgaaaagcctatcact
atgatattataa

DBGET integrated database retrieval system