KEGG   Monodelphis domestica (opossum): 100032298Help
Entry
100032298         CDS       T01031                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01522  Endocrine resistance
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04020  Calcium signaling pathway
mdo04024  cAMP signaling pathway
mdo04062  Chemokine signaling pathway
mdo04114  Oocyte meiosis
mdo04140  Autophagy - animal
mdo04211  Longevity regulating pathway
mdo04213  Longevity regulating pathway - multiple species
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04270  Vascular smooth muscle contraction
mdo04310  Wnt signaling pathway
mdo04340  Hedgehog signaling pathway
mdo04371  Apelin signaling pathway
mdo04530  Tight junction
mdo04540  Gap junction
mdo04611  Platelet activation
mdo04713  Circadian entrainment
mdo04714  Thermogenesis
mdo04720  Long-term potentiation
mdo04723  Retrograde endocannabinoid signaling
mdo04724  Glutamatergic synapse
mdo04725  Cholinergic synapse
mdo04726  Serotonergic synapse
mdo04727  GABAergic synapse
mdo04728  Dopaminergic synapse
mdo04740  Olfactory transduction
mdo04742  Taste transduction
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04910  Insulin signaling pathway
mdo04911  Insulin secretion
mdo04912  GnRH signaling pathway
mdo04913  Ovarian steroidogenesis
mdo04914  Progesterone-mediated oocyte maturation
mdo04915  Estrogen signaling pathway
mdo04916  Melanogenesis
mdo04918  Thyroid hormone synthesis
mdo04919  Thyroid hormone signaling pathway
mdo04921  Oxytocin signaling pathway
mdo04922  Glucagon signaling pathway
mdo04923  Regulation of lipolysis in adipocytes
mdo04924  Renin secretion
mdo04925  Aldosterone synthesis and secretion
mdo04926  Relaxin signaling pathway
mdo04927  Cortisol synthesis and secretion
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo04934  Cushing's syndrome
mdo04961  Endocrine and other factor-regulated calcium reabsorption
mdo04962  Vasopressin-regulated water reabsorption
mdo04970  Salivary secretion
mdo04971  Gastric acid secretion
mdo04976  Bile secretion
mdo05012  Parkinson's disease
mdo05020  Prion diseases
mdo05030  Cocaine addiction
mdo05031  Amphetamine addiction
mdo05032  Morphine addiction
mdo05146  Amoebiasis
mdo05165  Human papillomavirus infection
mdo05166  HTLV-I infection
mdo05169  Epstein-Barr virus infection
mdo05200  Pathways in cancer
mdo05203  Viral carcinogenesis
mdo05205  Proteoglycans in cancer
mdo05414  Dilated cardiomyopathy (DCM)
Module
mdo_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100032298
   04010 MAPK signaling pathway
    100032298
   04310 Wnt signaling pathway
    100032298
   04340 Hedgehog signaling pathway
    100032298
   04371 Apelin signaling pathway
    100032298
   04020 Calcium signaling pathway
    100032298
   04024 cAMP signaling pathway
    100032298
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100032298
  Cell growth and death
   04114 Oocyte meiosis
    100032298
  Cellular community - eukaryotes
   04530 Tight junction
    100032298
   04540 Gap junction
    100032298
 Organismal Systems
  Immune system
   04611 Platelet activation
    100032298
   04062 Chemokine signaling pathway
    100032298
  Endocrine system
   04911 Insulin secretion
    100032298
   04910 Insulin signaling pathway
    100032298
   04922 Glucagon signaling pathway
    100032298
   04923 Regulation of lipolysis in adipocyte
    100032298
   04912 GnRH signaling pathway
    100032298
   04913 Ovarian Steroidogenesis
    100032298
   04915 Estrogen signaling pathway
    100032298
   04914 Progesterone-mediated oocyte maturation
    100032298
   04921 Oxytocin signaling pathway
    100032298
   04926 Relaxin signaling pathway
    100032298
   04918 Thyroid hormone synthesis
    100032298
   04919 Thyroid hormone signaling pathway
    100032298
   04928 Parathyroid hormone synthesis, secretion and action
    100032298
   04916 Melanogenesis
    100032298
   04924 Renin secretion
    100032298
   04925 Aldosterone synthesis and secretion
    100032298
   04927 Cortisol synthesis and secretion
    100032298
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100032298
   04270 Vascular smooth muscle contraction
    100032298
  Digestive system
   04970 Salivary secretion
    100032298
   04971 Gastric acid secretion
    100032298
   04976 Bile secretion
    100032298
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100032298
   04961 Endocrine and other factor-regulated calcium reabsorption
    100032298
  Nervous system
   04724 Glutamatergic synapse
    100032298
   04727 GABAergic synapse
    100032298
   04725 Cholinergic synapse
    100032298
   04728 Dopaminergic synapse
    100032298
   04726 Serotonergic synapse
    100032298
   04720 Long-term potentiation
    100032298
   04723 Retrograde endocannabinoid signaling
    100032298
  Sensory system
   04740 Olfactory transduction
    100032298
   04742 Taste transduction
    100032298
   04750 Inflammatory mediator regulation of TRP channels
    100032298
  Aging
   04211 Longevity regulating pathway - mammal
    100032298
   04213 Longevity regulating pathway - multiple species
    100032298
  Environmental adaptation
   04713 Circadian entrainment
    100032298
   04714 Thermogenesis
    100032298
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100032298
   05205 Proteoglycans in cancer
    100032298
   05203 Viral carcinogenesis
    100032298
  Neurodegenerative diseases
   05012 Parkinson's disease
    100032298
   05020 Prion diseases
    100032298
  Substance dependence
   05030 Cocaine addiction
    100032298
   05031 Amphetamine addiction
    100032298
   05032 Morphine addiction
    100032298
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100032298
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100032298
  Infectious diseases
   05166 HTLV-I infection
    100032298
   05169 Epstein-Barr virus infection
    100032298
   05165 Human papillomavirus infection
    100032298
   05146 Amoebiasis
    100032298
  Drug resistance
   01522 Endocrine resistance
    100032298
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100032298
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: AGC group
  PKA family
   100032298
Messenger RNA biogenesis [BR:mdo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100032298
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100032298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100032298
NCBI-ProteinID: XP_016282703
Position
Un
AA seq 351 aa AA seqDB search
MGNAATAKKGSELESVKEFLAKAKEEFLKKWEAPAQNTAQLEHFDRIKTLGTGSFGRVML
VKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNTNLYMV
MEYVLGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFST
TDWIAIYQRKVEAPFIPKCKGPGDTSNFEDYEEEEIRVSITEKCAKEFAEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcggccaccgccaagaagggcagcgagctggagagcgtgaaagaattcctg
gccaaggccaaggaagaatttctcaagaaatgggaagccccggcgcagaacacggcccag
ctcgagcactttgaccgcatcaagaccctgggcacgggctcgttcgggcgcgtgatgctg
gtgaaacacaaggagacgggcaaccactttgccatgaaaatcctggataaacagaaggtg
gtgaagctgaagcagatcgagcacaccctgaacgagaagcgcatcctgcaggctgtcaac
ttcccctttctcgtccggctcgaatattccttcaaggacaacaccaacctgtacatggtg
atggagtacgtgctgggcggggagatgttctcccacctgcggcgcatcggccggttcagc
gagccccacgcacgcttctatgctgcccagatcgtcctgaccttcgagtacctccactcc
ctggacctgatctaccgggacctgaagcccgagaaccttctcatcgaccagcatggctac
atccaggtgacagactttgggtttgccaagcgcgtcaaaggccgcacctggaccctgtgc
gggacccccgagtacctggctcccgagatcatccttagcaagggctacaacaaggccgtg
gactggtgggccctgggagtcctgatctacgagatggcagcgggctacccccccttcttt
gctgaccagcccatccagatctacgaaaagatcgtttccggcaaggttcggttcccctcc
cacttcagctccgacctgaaggacctgcttcgcaacctgctccaggtggacctcaccaag
cgctacgggaacctcaagaatggagtcaacgacatcaaaaaccacaagtggttttccacc
accgactggatcgccatctaccagaggaaggtggaagctcccttcatccccaagtgcaag
ggccctggtgacacgagtaacttcgaagactacgaggaggaagagatccgagtctccatc
accgagaagtgcgccaaggagtttgctgagttctag

DBGET integrated database retrieval system