KEGG   Monodelphis domestica (opossum): 100032395Help
Entry
100032395         CDS       T01031                                 

Gene name
ACSS2
Definition
acyl-CoA synthetase short-chain family member 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100032395 (ACSS2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100032395 (ACSS2)
   00620 Pyruvate metabolism
    100032395 (ACSS2)
   00640 Propanoate metabolism
    100032395 (ACSS2)
Enzymes [BR:mdo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100032395 (ACSS2)
Lipid biosynthesis proteins [BR:mdo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100032395 (ACSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 697 aa AA seqDB search
MGLPEERSGSGSGSGSGSGERARSWSPPPELSRAAHVPSMARYRELHGRSVLEPREFWGD
IAKEFYWKTPCSGPFLQYNFDVTKGKIFIEWMKGATTNICYNLLDRNVNEKKLGDRVAFY
WEGNEPGEATQITYRELLTQVCRCANALRKQGIRKGDRVSIYMPMILELVVAMLACARLG
ALHSIVFAGFSADSLCERILDSSCTLLITADAFYRGEKLVNLKELVDDALHKCREKGFPV
KRCIVVKHLGRAELGTGDSPSHSPPLKRPCQDLQIPWNQGVDLWWHEILGDSEEECEPEW
CDAEDPLFILYTSGSTGKPKGVVHTTGGYMLYTATSFKYVFDFHEDDVFWCTADIGWITG
HSYVTYGPLANGATSVLFEGIPTYPDVSRLWNIVDKYKVTKFYTAPTAIRLLMKFGDEPV
NKYSRASLRVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPM
KPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFEATYFRKF
PGYYVTGDGCRRDEDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHKAIAEAAVVSHPH
PVKGECLYCFVTLREGHAFTPALAEELKKQVREKISPIATPDYIQNAPGLPKTRSGKIMR
RVLRKIAQNDHDLGDTSTVADQSVISHLFSHRCQTAL
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcctgaggaacggagtggctccggcagtgggagcgggagtgggagcggggag
cgggcacggagctggtccccgccacctgagctcagccgcgcggcgcacgtcccctccatg
gcgcgctaccgggagctgcacgggcgctcggtgctcgagcctcgggagttttggggagat
attgccaaggaattttactggaagactccatgttctggccccttcctccagtataatttt
gatgtcactaaggggaagatcttcattgaatggatgaagggagcaaccaccaacatctgc
tacaacctgctagaccgaaatgttaatgagaagaaacttggagaccgagtggccttttac
tgggaaggcaatgaacctggggaagctacccagatcacttaccgagagctcctgacccag
gtgtgtcggtgtgctaatgccctccggaaacagggcattcggaaaggagatcgtgtatcc
atctacatgcccatgattctggagctggtggtggccatgcttgcctgtgctcgtcttggt
gcattgcattctattgtgtttgcaggcttctcagctgattccctatgtgagcggatcctg
gactcaagctgtaccctccttattacggcagatgccttctacagaggagaaaaactagtg
aacctgaaagagcttgtggatgatgccctgcacaagtgccgggagaagggcttccctgta
aagagatgcattgtagtcaagcaccttggccgcgcggagctgggcacgggtgattctcct
agccattcccctccattgaaaaggccatgccaggacctgcagatcccctggaatcagggg
gtcgatctgtggtggcatgagatcctgggggattcagaggaggagtgtgagcctgagtgg
tgtgacgcagaggacccactcttcatcctttacaccagtggttccactggaaaacccaag
ggagtggtacacacgacagggggatatatgctgtacacggccacctctttcaagtatgtc
tttgacttccacgaggatgatgtgttttggtgcactgcagacatcggctggattactggg
cactcctatgtcacctatgggcctctggctaatggggctaccagtgtcctgtttgaggga
attcctacgtaccctgatgtgagccgcttgtggaacattgtggacaagtacaaggtgacc
aagttctacacagcacccacagctatccgcctgcttatgaagtttggggatgagcctgtc
aacaaatacagtcgggcatcccttcgggtattagggacagtgggcgagcccatcaaccca
gaagcctggctgtggtaccatcgggtggtgggagcgcagcgctgccctattgtggacacc
ttctggcagacagagacaggtggccatatgctgacccctctccctggtgccacacccatg
aagccaggttctgcgacttttccattcttcggtgtggcaccagcaatcttgaatgagtct
ggggaggagttggaaggagaagcagaaggttacctggtgttcaaacaaccctggcctggg
atcatgcgtacagtctatgggaaccatgagcgctttgaggccacctacttccggaagttc
ccaggctactatgtaacaggggatggttgtcggcgagatgaagatggctattactggatc
acaggccgaatcgacgacatgctcaatgtgtctggccacttgctgagtacagcggaagta
gagtcagcactggtggagcacaaggccattgctgaggcagctgtggtcagccacccacac
cctgtgaagggtgaatgtctttactgctttgtcactttacgggagggccatgcctttact
cctgcccttgctgaggagctcaagaagcaggttagagaaaaaatcagccctattgctact
ccggattacatccagaatgcacctggcttgcccaaaacacgctcagggaagatcatgagg
cgggtcctgaggaagatcgcacagaatgaccatgacctgggagacacatccactgtagct
gaccagtctgtcatcagccatcttttcagccaccgctgccagacagcactatga

DBGET integrated database retrieval system