KEGG   Monodelphis domestica (opossum): 100032605Help
Entry
100032605         CDS       T01031                                 

Gene name
AGPAT5
Definition
1-acylglycerol-3-phosphate O-acyltransferase 5
Organism
mdo  Monodelphis domestica (opossum)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 366 aa AA seqDB search
MLLSLVLHTYSMRYVLPAAVMLGTAPTYILAWLGWRLFSFFLPGTRLYREVDDRFYTIYQ
SMVLFFFENYTGVQVKLYGDLPKHKENIIYLSNHQCTVDWIIADILAVRQNALGHVRYVL
KNGLKWLPLYGWYFSQHGGIYVKRSSRFNEMEMRNKLENQMDSDTPMYLVIFPEGTRYNP
ELTKVISASQIYAAEQGLPVLKHVLTPRIKATYVAFDCMKNYLDAIYDVTVAYEGTVDQM
GKRKEAPSMAEFLCKECPKVHIHVDRIDKKDVPEDLSSMRRWLHDRFEIKDKLMREFYDS
SDPQNRNKFPGKCVDSKLSLKKTLPSLLFLGGLTASMLMTEAGRKLYVKTWIYGTVIGCL
LVSFKV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtccctggtgctccacacgtactccatgcgctatgtcctcccagctgctgtc
atgctgggtacggcccccacttatatactggcgtggctgggctggcgtcttttctccttc
ttcctacccggaacacgcctttaccgggaggtggatgatcgtttctacaccatctaccag
agcatggtgctcttcttcttcgaaaactacactggcgtccaggtaaaactatatggagat
ttgccaaaacataaagaaaatataatatacttatcaaatcatcagtgcacagttgactgg
attattgctgacattttggcagtcaggcagaatgctcttggacatgtacgatatgttctg
aaaaatggcttaaaatggcttccattgtatgggtggtatttttctcagcatggaggaatt
tatgtaaaacgaagttcccgttttaatgaaatggaaatgagaaacaagctagagaaccag
atggattcagacactccaatgtatcttgtgattttcccagagggaacaaggtacaatccg
gagctaacaaaagttatttcagctagtcaaatatatgctgctgaacaaggccttccagtg
ttaaaacatgtcttgacgccaagaataaaggcaacatatgttgcctttgactgtatgaag
aattacttagatgcaatttatgatgttacagtagcttacgaaggtactgtagatcaaatg
ggaaagagaaaagaagctccttctatggccgaatttctatgcaaagaatgtccaaaagtt
cacattcacgttgatcgcatagacaaaaaagatgtcccagaagacctgtcatcaatgaga
agatggcttcatgaccgctttgaaataaaagataagttgatgagagagttctatgattca
tcagatcctcaaaacagaaacaagtttccagggaaatgtgttgattccaaactaagcctc
aagaaaactttaccatctttactattcttaggtggtctgactgctagtatgctcatgaca
gaagctggaaggaaattgtatgtgaaaacttggatatatggaaccgtaattggctgcctg
ttggttagttttaaagtgtaa

DBGET integrated database retrieval system