KEGG   Monodelphis domestica (opossum): 100032605Help
Entry
100032605         CDS       T01031                                 

Gene name
AGPAT5
Definition
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase 5
  KO
K19007  
lysophosphatidiate acyltransferase [EC:2.3.1.51]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100032605 (AGPAT5)
   00564 Glycerophospholipid metabolism
    100032605 (AGPAT5)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     100032605 (AGPAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 366 aa AA seqDB search
MLLSLVLHTYSMRYVLPAAVMLGTAPTYILAWLGWRLFSFFLPGTRLYREVDDRFYTIYQ
SMVLFFFENYTGVQVKLYGDLPKHKENIIYLSNHQCTVDWIIADILAVRQNALGHVRYVL
KNGLKWLPLYGWYFSQHGGIYVKRSSRFNEMEMRNKLENQMDSDTPMYLVIFPEGTRYNP
ELTKVISASQIYAAEQGLPVLKHVLTPRIKATYVAFDCMKNYLDAIYDVTVAYEGTVDQM
GKRKEAPSMAEFLCKECPKVHIHVDRIDKKDVPEDLSSMRRWLHDRFEIKDKLMREFYDS
SDPQNRNKFPGKCVDSKLSLKKTLPSLLFLGGLTASMLMTEAGRKLYVKTWIYGTVIGCL
LVSFKV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtccctggtgctccacacgtactccatgcgctatgtcctcccagctgctgtc
atgctgggtacggcccccacttatatactggcgtggctgggctggcgtcttttctccttc
ttcctacccggaacacgcctttaccgggaggtggatgatcgtttctacaccatctaccag
agcatggtgctcttcttcttcgaaaactacactggcgtccaggtaaaactatatggagat
ttgccaaaacataaagaaaatataatatacttatcaaatcatcagtgcacagttgactgg
attattgctgacattttggcagtcaggcagaatgctcttggacatgtacgatatgttctg
aaaaatggcttaaaatggcttccattgtatgggtggtatttttctcagcatggaggaatt
tatgtaaaacgaagttcccgttttaatgaaatggaaatgagaaacaagctagagaaccag
atggattcagacactccaatgtatcttgtgattttcccagagggaacaaggtacaatccg
gagctaacaaaagttatttcagctagtcaaatatatgctgctgaacaaggccttccagtg
ttaaaacatgtcttgacgccaagaataaaggcaacatatgttgcctttgactgtatgaag
aattacttagatgcaatttatgatgttacagtagcttacgaaggtactgtagatcaaatg
ggaaagagaaaagaagctccttctatggccgaatttctatgcaaagaatgtccaaaagtt
cacattcacgttgatcgcatagacaaaaaagatgtcccagaagacctgtcatcaatgaga
agatggcttcatgaccgctttgaaataaaagataagttgatgagagagttctatgattca
tcagatcctcaaaacagaaacaagtttccagggaaatgtgttgattccaaactaagcctc
aagaaaactttaccatctttactattcttaggtggtctgactgctagtatgctcatgaca
gaagctggaaggaaattgtatgtgaaaacttggatatatggaaccgtaattggctgcctg
ttggttagttttaaagtgtaa

DBGET integrated database retrieval system