KEGG   Monodelphis domestica (opossum): 100032659Help
Entry
100032659         CDS       T01031                                 

Gene name
THBS2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100032659 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100032659 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100032659 (THBS2)
  Cell communication
   04510 Focal adhesion
    100032659 (THBS2)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100032659 (THBS2)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100032659 (THBS2)
  Exosomal proteins of colorectal cancer cells
   100032659 (THBS2)
  Exosomal proteins of bladder cancer cells
   100032659 (THBS2)
Heparan sulfate/heparin binding proteins [BR:mdo00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100032659 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1175 aa AA seqDB search
MLQGGRMLWWLVLLALWVFSSAQDGDAEDDTSFDLFEISNINRRTVGAKQFRGPDPTSPA
YRFIRFDHIPPVKAEILKKMIKMMRQNEGFFLTATLKQDKHSRGTLLALEGPGNSQRQFE
IISNGRANTLDLIYSGDKGQNVISLEDVDLADSHWKNITVQLTGETYGLYVGCDLIDSFI
LEEPFFEQLKAENSKMYVAKGSIRENHFRGFLQDVRLVFETSVEDVLIKRGCQRSQTAEM
NTINESTEILRLSSTEYVGPNTEKNAEVCERSCEELGSMINEISGLRSLVNTLTERLTKV
TNDNQVLWELVGVPLKVRNQTACWQDGRFFQDNETWVVDSCTKCTCKKFKTVCHQITCPA
VACANPIFVEGECCPSCSPFNDNEEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLG
PSIQTRMCSLGKCDNRIRQDGGWSHWSPWSSCSVTCGLGNITRIRLCNSPVPQLGGKNCK
GSGRETKECEKAPCPINGRWSPWSPWSACSVTCAGGIRERSRVCNNPEPQYGGKDCVGDV
KEHQMCNRRSCPIDGCLSNPCFPGAECNSFPDGSWSCGSCPVGYLGNGTHCEDLDECTVV
TDVCFISNKVHRCVNTNPGFHCLPCPPRYKGTQPFAVGLEAARTEKQVCEPENPCKDKTH
NCHKHSECIYLGHFSDPMYKCECKTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIK
DNCPHLPNSGQEDFDKDGIGDACDTDDDNDGVDDEKDNCPLLFNPRQSDYDKDEVGDRCD
NCPYVHNLAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDN
CPLMHNPDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDNDGKGDACD
SDDDNDGIPDDRDNCRLVFNPDQEDSDGDGRGDICKDDFDNDNVPDIDDVCPENNAISET
DFRKFQMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVN
TDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWENQPTRAYGYSGVSLKVVNSTTGTGEH
LRNALWHTGNTEGQVRTLWHDPKNVGWKDYTAYRWHLTHRPKTGYMRVLVHEGKQVMADS
GPIYDQTYAGGRLGLFVFSQEMVFFSDLKYECRDV
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atgctacagggaggtaggatgctctggtggctggtcctcttggctctctgggtattctcc
agtgcccaagatggtgatgcagaagatgatacttcctttgacctatttgaaatcagtaac
ataaacagaagaacagttggtgccaagcaattccgagggcctgaccctactagtccagca
tatcgctttattagatttgatcacattcccccagtgaaagctgagatcctgaagaagatg
ataaagatgatgaggcaaaatgagggcttcttcctcactgccactctaaagcaggacaaa
cattcacggggtacactcctggctttggaaggtccaggaaactctcaacggcagtttgag
attatatccaatggccgggccaacactcttgacctgatttactcaggagataagggccag
aatgtgatttctttagaggatgtggatctggctgattcccattggaaaaatatcactgtg
caactgacaggggagacctatggcctctatgtgggctgtgacctcattgacagtttcatt
ctggaggagcccttctttgagcagctgaaggctgagaatagcaagatgtatgtggccaaa
ggctccatccgagaaaatcatttcaggggtttccttcaagatgtccgtttagtttttgaa
acttctgtggaagatgttctcatcaaaagaggatgtcagcgaagccaaacagctgaaatg
aacaccatcaatgaaagcacagagatcctccgtcttagctcaacagaatatgttggtccc
aatacagagaaaaatgcagaagtctgtgagcgctcctgtgaagagttgggcagcatgatc
aatgaaatatcaggactgcgaagcctggtcaatacccttacagaacgcttaactaaagtg
acaaatgacaatcaagttctctgggaactcgttggtgtccctctaaaggtgaggaaccag
acagcatgttggcaggatggtcgtttctttcaagataatgagacctgggtggtggacagc
tgtactaaatgtacttgcaagaaatttaaaactgtttgccaccaaatcacctgcccagca
gtggcttgtgccaatcccatctttgttgaaggtgaatgctgtccttcctgttctcctttc
aatgacaacgaagaaggctggtccccatgggctgaatggacagaatgctctgtcacatgt
ggttcaggaacacaacagagaggacgctcgtgtgatgtcactagtaacacatgcctggga
ccctctatccagacaagaatgtgcagtcttggcaaatgtgacaaccgaatacggcaagat
ggtggctggagtcattggtccccttggtcttcctgctctgtaacctgtggattggggaac
atcactcgtatccgtctctgcaattctcctgtcccacagctgggaggaaagaattgtaaa
ggaagtggacgtgagacaaaagaatgcgaaaaggccccttgtccaattaatggccggtgg
agtccatggtctccctggtctgcctgctcagtaacatgtgcaggagggattcgtgagagg
tcccgggtctgtaacaatcctgagccacagtatggaggaaaagattgtgtgggagatgtc
aaagaacaccagatgtgcaacagacggagctgtccaattgatggatgcttatccaatcct
tgcttccctggagcagaatgtaatagtttccctgatggctcttggtcgtgtggctcttgc
ccagttggctacttaggaaatggcactcattgtgaagaccttgatgaatgcacagttgtc
acagatgtctgcttcatatccaataaagttcaccgctgtgtcaacaccaacccagggttc
cactgcctgccatgtcccccacgctacaaaggaacccagccctttgcagtggggctggag
gcagccagaacagaaaagcaagtttgtgaacctgaaaacccgtgcaaagacaagactcac
aactgccataagcattcagaatgcatctacctgggccatttcagtgatccaatgtacaag
tgtgaatgcaagactggttatgctggtgatgggcttatctgtggggaagactcagatcta
gatggctggcccaataaaaacctggtctgtgcaacaaatgctacctatcactgcattaag
gataactgtccccacctacctaattctggccaggaagattttgacaaagatggaattggt
gacgcttgtgatactgatgatgacaatgatggagtggatgatgagaaggacaattgtcct
cttctctttaatcctcgtcaatctgattatgacaaggatgaggttggagatcgctgtgat
aactgtccttatgtacacaaccttgctcagattgacacagacaataatggtgaaggtgat
gcttgttctgtagatatagatggagatgatgtttttaatgagagagacaattgtccttat
gtttacaatactgaccaaagggacactgatggtgatggggttggagatcactgtgataac
tgtcccttgatgcacaatcctgatcagactgatgtggataatgaccttgttggtgaccag
tgtgataacaatgaagacatagatgaagatggccaccagaataaccaagacaattgtccc
tacatatcaaatgctaatcaagctgaccatgataatgatggcaagggggatgcctgtgac
tctgatgatgacaatgatggcattccagatgacagggacaattgccgacttgttttcaat
cctgaccaggaggactcagatggtgatggaaggggtgatatttgtaaagatgactttgac
aatgataatgttccagatattgatgatgtgtgtccagaaaacaatgccatcagtgaaact
gattttagaaagttccaaatggtgcacttagaccctaagggaacaacccagatagatccc
aactgggtaattcgtcatcaagggaaggagctggtacagacagccaattctgatcctggt
atagctgtaggttttgatgaatttggttctgttgacttcagtggcacattttatgtcaat
actgaccgtgatgatgattatgctgggtttgtgtttggctaccaatcaagcagtcggttt
tatgttgtaatgtggaagcaggtcacccagacttattgggaaaaccaacccaccagagct
tatggctactcaggtgtatcactcaaagtggtaaattccaccactggaactggagaacat
ctcaggaatgctctatggcacacaggaaacacagaaggacaggttcgtaccttatggcat
gatcccaagaatgttggctggaaagattatactgcctacaggtggcatctgactcacaga
cccaagacaggttatatgagagttttagtacatgaagggaagcaagtcatggcagattca
ggaccaatttatgatcaaacttatgctgggggtcggttaggtctttttgtcttctcccaa
gaaatggtctttttctcagacctcaaatacgaatgccgagatgtctga

DBGET integrated database retrieval system