KEGG   Monodelphis domestica (opossum): 100032696Help
Entry
100032696         CDS       T01031                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00562  Inositol phosphate metabolism
mdo01100  Metabolic pathways
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo04012  ErbB signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04020  Calcium signaling pathway
mdo04064  NF-kappa B signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04070  Phosphatidylinositol signaling system
mdo04072  Phospholipase D signaling pathway
mdo04360  Axon guidance
mdo04370  VEGF signaling pathway
mdo04650  Natural killer cell mediated cytotoxicity
mdo04658  Th1 and Th2 cell differentiation
mdo04659  Th17 cell differentiation
mdo04660  T cell receptor signaling pathway
mdo04664  Fc epsilon RI signaling pathway
mdo04666  Fc gamma R-mediated phagocytosis
mdo04670  Leukocyte transendothelial migration
mdo04722  Neurotrophin signaling pathway
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04919  Thyroid hormone signaling pathway
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
mdo05169  Epstein-Barr virus infection
mdo05200  Pathways in cancer
mdo05205  Proteoglycans in cancer
mdo05206  MicroRNAs in cancer
mdo05214  Glioma
mdo05223  Non-small cell lung cancer
mdo05225  Hepatocellular carcinoma
mdo05231  Choline metabolism in cancer
Module
mdo_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100032696 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100032696 (PLCG1)
   04015 Rap1 signaling pathway
    100032696 (PLCG1)
   04012 ErbB signaling pathway
    100032696 (PLCG1)
   04370 VEGF signaling pathway
    100032696 (PLCG1)
   04064 NF-kappa B signaling pathway
    100032696 (PLCG1)
   04066 HIF-1 signaling pathway
    100032696 (PLCG1)
   04020 Calcium signaling pathway
    100032696 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100032696 (PLCG1)
   04072 Phospholipase D signaling pathway
    100032696 (PLCG1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100032696 (PLCG1)
   04660 T cell receptor signaling pathway
    100032696 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100032696 (PLCG1)
   04659 Th17 cell differentiation
    100032696 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100032696 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100032696 (PLCG1)
   04670 Leukocyte transendothelial migration
    100032696 (PLCG1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100032696 (PLCG1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100032696 (PLCG1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100032696 (PLCG1)
  Development
   04360 Axon guidance
    100032696 (PLCG1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100032696 (PLCG1)
   05231 Choline metabolism in cancer
    100032696 (PLCG1)
   05206 MicroRNAs in cancer
    100032696 (PLCG1)
   05205 Proteoglycans in cancer
    100032696 (PLCG1)
   05225 Hepatocellular carcinoma
    100032696 (PLCG1)
   05214 Glioma
    100032696 (PLCG1)
   05223 Non-small cell lung cancer
    100032696 (PLCG1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100032696 (PLCG1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100032696 (PLCG1)
   05169 Epstein-Barr virus infection
    100032696 (PLCG1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100032696 (PLCG1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100032696 (PLCG1)
Membrane trafficking [BR:mdo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100032696 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100032696 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 100032696
NCBI-ProteinID: XP_001381645
Ensembl: ENSMODG00000000626
Position
1
AA seq 1292 aa AA seqDB search
MMAGAGAPFANGCGSCAPSEAEVLNLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQ
ITWSRGADKIEGAVDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKT
LSLQATSEDEVNMWIKGLNWLVTDTTQSATPLQIERWLRKQFYSVDRNREDRISAKDLKN
MLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMFSAQKTMDLPFLEAGTLR
GGDRPELCRVSLAEFQQFLLEYQGELWATDRLQVQEFMLNFLRDPLREIEEPYFFLDEFV
TFLFSKENNIWNSQLDLVCVDTMNNPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLRM
GCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVTSEYPVILSIEDHCSI
AQQRNMAQYFKKVFGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSV
MYSENDISNSIKNGILYLEDPINHEWYPHYFVLTSSKIYYSEETNSDQGNDDEEEPKEVN
SSAELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSF
WRNGKVQHCRIHSRQDAGSPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLTEPVPQ
TNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRSEPNSYAISFRAEGKIKHCRVQQ
EGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRN
PGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQL
WFPSNYVEEMASPAALEPEREQLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSI
SMASIAHWSLDVAADSQEDLQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVIY
CRPVPFDEDKIGTERACYRDMSSFPETKAEKYVNKTKGKKFLQYNRLQLSRIYPKGQRLD
SSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMSSGRCGYVMQPSNMRDEAFDPFDK
CSLRGIEPCAVCIEVLGARHLPKNGRGIVCPFVEIEVAGADYDNMKHKTEFVVDNGLNPV
WPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFLVKGLKTGYRAVPLKNNYSED
LELASLLIKIDIFPAKQENGEVSPFGSSSFRERGSEAPGQLLHGRTREGSFEARYQQPFE
DFRISQEHLADHFDGRERRALRRTRVNGDNRL
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaggggcgggagcccctttcgccaatggctgcgggtcctgcgccccatccgag
gccgaggttctgaatctctgccggagtttggaagtgggcaccgtcatgaccttgttctac
tccaagaaatcccagcgaccggagaggaaaaccttccaggtcaagttggagaccaggcag
atcacgtggagccgtggggcagataaaatcgaaggagccgttgatattcgtgaaatcaag
gagattcgcccaggaaagacctctcgtgactttgaccgttatcaggaagacccggctttc
cggcctgaccagtcccattgctttgtcatcctgtatggcatggaattccgcctgaaaacc
cttagtctgcaagccacctcggaggacgaagtgaacatgtggatcaaaggcttgaattgg
cttgtgactgacaccacccagtctgccactcctctgcagattgagaggtggcttcggaag
cagttctactcagtagatcggaatcgggaagacaggatttctgccaaggatcttaagaac
atgctgtcccaggtcaactaccgagttcccaacatgcggttcctgagggaacggttgacg
gatctggagcagcggagtggggacatcacctatggacagtttgcacagctctaccggagc
ctcatgttcagcgcccagaaaacgatggaccttcctttcctggaagctggcaccctgagg
ggtggagatcgacctgagctctgcagagtgtccctggctgagtttcagcagtttcttttg
gaataccagggggagctgtgggccactgaccggctccaggtgcaggagttcatgctcaac
ttcctccgagatccactccgagagatagaggagccttacttcttcctggatgagtttgtt
accttcctgttctccaaagagaacaacatctggaactcccagctggatttggtgtgtgtc
gacaccatgaataatcccttgtctcagtattggatctcttcatcccataacacgtacctg
actggggaccagttctccagcgagtcctccttggaggcctacgcacggtgtcttcgcatg
ggctgtcgatgcattgagttggactgttgggatgggccagatgggatgcctgtcatttac
cacggacataccctcaccaccaagatcaagttctctgacgttctccataccatcaaggag
catgcgttcgtgacctcagagtacccagtgatcttgtccattgaagatcattgtagcatt
gctcagcagagaaacatggcccagtacttcaagaaagtatttggtgacacccttcttacc
aagcctgtggacatcgccgctgatggtctgccttcccccaaccagctcaagagaaaaatc
cttattaagcacaagaagctggccgagggcagtgcctacgaggaggtgcccacatcagtg
atgtactcggagaatgacatcagcaattccatcaagaatggcatcctctacttggaagat
cccattaaccatgagtggtacccgcactactttgtactgaccagcagcaaaatctactac
tcagaggagacaaatagtgaccagggcaacgatgatgaggaggaaccaaaggaggtgaat
agcagtgcagagctacactccagtgagaaatggttccatggcaagctaggcgctggtcgt
gatgggcggcacattgctgagcgactgctcactgaatactgcattgagacgggagcccct
gatggctcctttctggttcgagagagcgagacctttgtcggggactacacactctccttc
tggcggaatgggaaggtccagcattgccggatccactcacgccaggatgccgggagcccc
aaattctttttgacagacaacctggtatttgactcgctctacgacctcatcacccactac
cagcaggtgccattgagatgcaatgagttcgagatgcgccttacggagcctgtgcctcag
accaatgcccacgagagcaaagagtggtaccatgcaagtctgacccgcgcccaggcggag
cacatgttaatgcgtgtaccccgggatggagccttccttgtgcgaaaacggagtgagccc
aactcctatgccatctccttccgggctgaaggcaagatcaaacactgccgcgtccagcag
gaggggcagactgtgatgctggggaactctgagtttgacagcctcgtggacctcatcagt
tactatgagaagcatccgctgtaccgaaagatgaagctccggtaccccatcaatgaggag
gcactagagaagattggcacagcggagccagactatggagctctctatgaaggacggaac
ccaggtttctatgtggaagcaaatcctatgccaacttttaagtgtgcagtcaaagccctc
tttgactacaaggcacagagagaagatgagctgacctttacgaagagtgccatcattcag
aatgtagaaaagcaggagggaggctggtggaggggagactacggagggaagaagcagcta
tggtttccatcaaattatgtggaagagatggccagccccgctgctctagagcctgagagg
gagcagctggatgagaatagccccctgggagatctgctccgtggagtcctggatgtgcca
gcctgtcagattgctatccgcccagaggggaagaacaaccgcctgttcgtattctccatt
agcatggcctccattgcacattggtccctggatgtggctgctgattcccaggaggaccta
caggactgggtgaaaaagatccgggaggtggcccagaccgcagatgcccggctcacagag
gggaagatgatggaacgaaggaagaaaatcgccttggagctgtctgaactcgtcatctac
tgtcggcccgtccccttcgatgaggacaagatcggcaccgagcgggcctgttaccgagac
atgtcgtccttcccggagaccaaggcggagaagtacgtgaataagaccaagggcaagaag
ttcttacagtataatcggcttcagctgtcccgcatctaccccaagggccagcggctggac
tcctctaactatgaccccctgcccatgtggatctgtggcagtcagctcgtggccctcaac
ttccagacgccagacaaacccatgcagatgaaccaggccttgttcatgtccagtgggcgc
tgtggctatgtgatgcagccaagcaacatgagagatgaagcctttgacccctttgacaag
tgcagcttgcgggggatagagccatgtgcagtctgcattgaggtcctgggggcccggcat
ctccccaagaacggtcgtggcatcgtgtgccctttcgtggagattgaggtagcgggggcc
gactacgacaacatgaagcacaagaccgaatttgtggtggacaatggcctgaaccccgtg
tggccggcaaagcccttccacttccagattagcaaccctgagtttgctttcctgcgcttt
gtggtgtatgaagaagacatgttcagcgaccagaatttcttggctcaggctaccttcctt
gtgaaaggcctaaagacaggatacagagcggtgcctttgaagaacaactacagcgaggat
ctggagctggcctcgctgcttatcaaaatagatatatttcctgccaagcaggagaacggt
gaagtcagtccctttggcagctcctcattccgagaacggggctccgaagctccgggccag
ctactccacggacggacccgagagggctcctttgaagcccgctatcagcagccatttgag
gatttccgcatctcccaggagcacctagcagaccactttgacggccgggaacgaagggcc
cttcggagaactcgtgtcaacggagacaaccgcctctag

DBGET integrated database retrieval system