KEGG   Monodelphis domestica (opossum): 100032745Help
Entry
100032745         CDS       T01031                                 

Gene name
PPOX
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mdo00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 473 aa AA seqDB search
MSRTVVVLGGGISGLAACYHLIRAPRPPKVVLIEASQRLGGWIRSVQREDGAVFELGPRG
IRPAGELGARTLLMVSELGLDSAILPVPGNHPAAQNRFLYVGGALHPLPTGLRGLFFPAP
PFSKPLFWAGLRELTTPRGLEPDETVHSFAERRLGSEVASIAMDSLCRGVFAGDSRVLSV
RSCFPSLFKAEQTHRSVLLGLLLGSGQSLLLESPLISQARAERWSQWSLRGGLETLPQTL
GTHLLSQGVTILKGQPVCGLNFQLGKWQVSLGDCSLEADHIISAIPATVLSELLPSEAAP
LAQTLALIRAASVAVVNLQYREAHLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSPA
SLRVTVMLGGSWLQALEDGEQTLAQELFQQAAQEAVATQLGLRKPPSQSLVSLHKSCIPQ
YTLGHWQRLEAAAQFLANHQLPLTLAGASYEGVSVNDCIESGRRAATHVLKES
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggaccgtggtcgtgctgggcggtggcatcagcggcttggccgcgtgttaccac
ctgatccgggcccctcggcctcccaaggtggtcctgatcgaagccagtcaacgtcttggg
ggctggattcgttcagtccaacgagaggatggagctgtctttgaactcggaccccgagga
attcgtcctgccggagaattaggagccaggaccttgctcatggtctcagagcttggcttg
gactctgcaattttgcctgttcccgggaaccatcctgctgctcaaaaccgcttcctgtat
gtggggggagctctgcaccctctgcctactggccttaggggcttgttctttccagcccct
cctttctccaagccgctgttctgggctggccttcgggagctgaccacccctcgtggcctg
gaacctgatgagactgtgcacagctttgcagagaggcgcctgggatctgaggtggcctct
atcgctatggatagtctttgccgaggagtatttgccggcgatagtcgagtgctcagcgtc
cgctcctgcttccccagcctctttaaggccgagcagactcatcggtctgtgcttctgggg
ttgttgctggggtcagggcagagcctcctcttagagtcacctctgattagtcaggccaga
gctgagcgctggagccagtggtcacttcggggagggctggagacactgccccagaccttg
ggcacccacctgttaagtcaaggagtcaccattctgaagggtcagccggtctgtgggctc
aacttccagttgggtaaatggcaggtgtctctaggagattgcagcctggaggccgatcac
atcattagtgctatccctgctacagtgctaagcgagctgcttccttctgaggcagcacct
ctggctcagaccctggccctaattcgtgctgcctctgtggctgttgtgaatttgcagtat
cgggaggctcatctgcctgtccagggttttggacacctggtaccttcttctgaagaccct
ggcgtcctgggaattgtatatgactccgttgccttccctgaacaggatgggagccctgcc
agccttagagtgaccgtgatgctggggggttcttggctgcaagcactggaggatggagag
caaacattagctcaggagctattccaacaagcagcccaggaagcagttgccacacaattg
gggctaagaaagccaccgagtcaaagcctggttagcctacacaagagctgtatccctcaa
tatactttgggccactggcagagattagaggcagctgcccagtttctggccaatcatcaa
ctgcccctgactctagcaggagcatcctatgaaggtgtttcagtcaatgactgtatagag
agtggtcgcagggctgccactcatgtcttgaaggaatcttga

DBGET integrated database retrieval system