KEGG   Monodelphis domestica (opossum): 100033067Help
Entry
100033067         CDS       T01031                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mdo00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:mdo03320]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:mdo05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 456 aa AA seqDB search
MVVNSNRRRGNDNFKDIESKFALRTPEEITEDRCHLVPGDINSVAGCNFNHSSKTFVVIH
GWTVTGMYESWVPKLVGALFKREPDSNVIVVDWLSRAQQHYPVSAGYTKVVGQDVARFIN
WLSEQFNYPLDNIHFLGYSLGAHAAGVAGSLTNKKINRITGLDPAGPNFEYAEAPSRLSP
DDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGFFQPGCNLFDAINQIATKGLGDM
DQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFDKGLCLSCKKNRCNNMGYEINKV
RAKRSSKMYLKTRSQMPYKVFHYQVKLHFLGTESVTQINQVLLLSLYGTIAESEDISITL
PEMSTNKTYSFLIYTEIDIGELLMVKVQWKSDSFFSWSDWWSSTGFGIQKIRVKAGETQK
KVVFCSRENISHLKKGKDPVAFMKCYDKSLNKKDVW
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgaattctaaccgaagaagaggaaatgacaattttaaagacattgaaagcaaa
tttgctctcaggacaccagaggaaatcactgaggatagatgccatcttgttcctggagac
atcaattctgtggctggctgtaacttcaatcatagcagcaaaacctttgtggtgattcat
ggatggacggtgacaggaatgtatgagagttgggtgcccaaacttgtaggggctctgttc
aagagggagccagactccaacgtcattgtagtcgattggctgtcaagagcccaacagcac
tatccagtatctgccggttacacaaaggtggtgggacaagatgtcgccagatttatcaat
tggttgtcggagcagttcaactacccactagacaacattcatttcttggggtacagtctt
ggagcccatgctgctggtgttgcaggaagtctgacaaataagaagattaacagaattact
ggcttagatcctgctggtcctaattttgaatatgctgaagctcccagtcgcctttctcca
gatgatgcagattttgtagatgtcttgcacactttcactcgaggatctccgggtagaagt
attggaatccagaagccagtgggccatgttgacatttatcctaatggaggcttctttcaa
ccagggtgcaatctttttgatgctattaatcaaattgcaacaaaaggtcttggagatatg
gatcagctagtaaagtgctctcatgaacggtccattcatctcttcattgactctctcctg
aatgaagaaaacccaagtaaggcataccgttgcagttcaaaggaagcctttgataaaggg
ctctgcttaagctgtaagaagaatcgctgcaacaacatgggttatgagatcaataaagtg
agagccaagagaagcagcaaaatgtacctgaagacccgttctcagatgccctacaaagtt
ttccattatcaagtgaagttacattttcttgggactgaaagtgtgactcagatcaatcag
gtgttgttgctctctctgtatggcaccatagctgagagtgaagacatctctattaccctg
cctgaaatgtccaccaacaagacttattcctttctgatttacactgagatcgatattgga
gaactactcatggtgaaagtacagtggaaaagtgattctttctttagctggtctgactgg
tggagcagcactggttttggcatccagaaaatcagagtcaaagcaggagaaactcagaaa
aaggttgtcttctgttccagagaaaatatatcccatttgaagaaaggaaaagaccctgtg
gcatttatgaaatgctatgacaaatcactgaacaaaaaggatgtctggtaa

DBGET integrated database retrieval system