KEGG   Monodelphis domestica (opossum): 100033067Help
Entry
100033067         CDS       T01031                                 

Gene name
LPL
Definition
lipoprotein lipase
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100033067 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100033067 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100033067 (LPL)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100033067 (LPL)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100033067 (LPL)
  Exosomal proteins of breast milk
   100033067 (LPL)
Heparan sulfate/heparin binding proteins [BR:mdo00536]
 Enzymes (General comment) Variety
  100033067 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 479 aa AA seqDB search
MEGKALILVALGLCFQSLTTSTGVAAASSNRRRGNDNFKDIESKFALRTPEEITEDRCHL
VPGDINSVAGCNFNHSSKTFVVIHGWTVTGMYESWVPKLVGALFKREPDSNVIVVDWLSR
AQQHYPVSAGYTKVVGQDVARFINWLSEQFNYPLDNIHFLGYSLGAHAAGVAGSLTNKKI
NRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNG
GFFQPGCNLFDAINQIATKGLGDMDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEA
FDKGLCLSCKKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKLHFLGTESVT
QINQVLLLSLYGTIAESEDISITLPEMSTNKTYSFLIYTEIDIGELLMVKVQWKSDSFFS
WSDWWSSTGFGIQKIRVKAGETQKKVVFCSRENISHLKKGKDPVAFMKCYDKSLNKKDV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggagggcaaagcattgatcctggtcgccctaggtttgtgcttccagagtctgaccaca
tccacaggggtggccgctgcctcctcgaacagaagaagaggaaatgacaattttaaagac
attgaaagcaaatttgctctcaggacaccagaggaaatcactgaggatagatgccatctt
gttcctggagacatcaattctgtggctggctgtaacttcaatcatagcagcaaaaccttt
gtggtgattcatggatggacggtgacaggaatgtatgagagttgggtgcccaaacttgta
ggggctctgttcaagagggagccagactccaacgtcattgtagtcgattggctgtcaaga
gcccaacagcactatccagtatctgccggttacacaaaggtggtgggacaagatgtcgcc
agatttatcaattggttgtcggagcagttcaactacccactagacaacattcatttcttg
gggtacagtcttggagcccatgctgctggtgttgcaggaagtctgacaaataagaagatt
aacagaattactggcttagatcctgctggtcctaattttgaatatgctgaagctcccagt
cgcctttctccagatgatgcagattttgtagatgtcttgcacactttcactcgaggatct
ccgggtagaagtattggaatccagaagccagtgggccatgttgacatttatcctaatgga
ggcttctttcaaccagggtgcaatctttttgatgctattaatcaaattgcaacaaaaggt
cttggagatatggatcagctagtaaagtgctctcatgaacggtccattcatctcttcatt
gactctctcctgaatgaagaaaacccaagtaaggcataccgttgcagttcaaaggaagcc
tttgataaagggctctgcttaagctgtaagaagaatcgctgcaacaacatgggttatgag
atcaataaagtgagagccaagagaagcagcaaaatgtacctgaagacccgttctcagatg
ccctacaaagttttccattatcaagtgaagttacattttcttgggactgaaagtgtgact
cagatcaatcaggtgttgttgctctctctgtatggcaccatagctgagagtgaagacatc
tctattaccctgcctgaaatgtccaccaacaagacttattcctttctgatttacactgag
atcgatattggagaactactcatggtgaaagtacagtggaaaagtgattctttctttagc
tggtctgactggtggagcagcactggttttggcatccagaaaatcagagtcaaagcagga
gaaactcagaaaaaggttgtcttctgttccagagaaaatatatcccatttgaagaaagga
aaagaccctgtggcatttatgaaatgctatgacaaatcactgaacaaaaaggatgtctga

DBGET integrated database retrieval system