KEGG   Monodelphis domestica (opossum): 100033067Help
Entry
100033067         CDS       T01031                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100033067 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100033067 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    100033067 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100033067 (LPL)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100033067 (LPL)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100033067 (LPL)
  Exosomal proteins of breast milk
   100033067 (LPL)
Glycosaminoglycan binding proteins [BR:mdo00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   100033067 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mdo00537]
 Enzymes
  100033067 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
1
AA seq 479 aa AA seqDB search
MEGKALILVALGLCFQSLTTSTGVAAASSNRRRGNDNFKDIESKFALRTPEEITEDRCHL
VPGDINSVAGCNFNHSSKTFVVIHGWTVTGMYESWVPKLVGALFKREPDSNVIVVDWLSR
AQQHYPVSAGYTKVVGQDVARFINWLSEQFNYPLDNIHFLGYSLGAHAAGVAGSLTNKKI
NRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNG
GFFQPGCNLFDAINQIATKGLGDMDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEA
FDKGLCLSCKKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKLHFLGTESVT
QINQVLLLSLYGTIAESEDISITLPEMSTNKTYSFLIYTEIDIGELLMVKVQWKSDSFFS
WSDWWSSTGFGIQKIRVKAGETQKKVVFCSRENISHLKKGKDPVAFMKCYDKSLNKKDV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggagggcaaagcattgatcctggtcgccctaggtttgtgcttccagagtctgaccaca
tccacaggggtggccgctgcctcctcgaacagaagaagaggaaatgacaattttaaagac
attgaaagcaaatttgctctcaggacaccagaggaaatcactgaggatagatgccatctt
gttcctggagacatcaattctgtggctggctgtaacttcaatcatagcagcaaaaccttt
gtggtgattcatggatggacggtgacaggaatgtatgagagttgggtgcccaaacttgta
ggggctctgttcaagagggagccagactccaacgtcattgtagtcgattggctgtcaaga
gcccaacagcactatccagtatctgccggttacacaaaggtggtgggacaagatgtcgcc
agatttatcaattggttgtcggagcagttcaactacccactagacaacattcatttcttg
gggtacagtcttggagcccatgctgctggtgttgcaggaagtctgacaaataagaagatt
aacagaattactggcttagatcctgctggtcctaattttgaatatgctgaagctcccagt
cgcctttctccagatgatgcagattttgtagatgtcttgcacactttcactcgaggatct
ccgggtagaagtattggaatccagaagccagtgggccatgttgacatttatcctaatgga
ggcttctttcaaccagggtgcaatctttttgatgctattaatcaaattgcaacaaaaggt
cttggagatatggatcagctagtaaagtgctctcatgaacggtccattcatctcttcatt
gactctctcctgaatgaagaaaacccaagtaaggcataccgttgcagttcaaaggaagcc
tttgataaagggctctgcttaagctgtaagaagaatcgctgcaacaacatgggttatgag
atcaataaagtgagagccaagagaagcagcaaaatgtacctgaagacccgttctcagatg
ccctacaaagttttccattatcaagtgaagttacattttcttgggactgaaagtgtgact
cagatcaatcaggtgttgttgctctctctgtatggcaccatagctgagagtgaagacatc
tctattaccctgcctgaaatgtccaccaacaagacttattcctttctgatttacactgag
atcgatattggagaactactcatggtgaaagtacagtggaaaagtgattctttctttagc
tggtctgactggtggagcagcactggttttggcatccagaaaatcagagtcaaagcagga
gaaactcagaaaaaggttgtcttctgttccagagaaaatatatcccatttgaagaaagga
aaagaccctgtggcatttatgaaatgctatgacaaatcactgaacaaaaaggatgtctga

DBGET integrated database retrieval system