KEGG   Monodelphis domestica (opossum): 100033182Help
Entry
100033182         CDS       T01031                                 

Gene name
ELP3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100033182 (ELP3)
Transfer RNA biogenesis [BR:mdo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100033182 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 547 aa AA seqDB search
MKQKRKGDLSPAELMILTIGDVIKQLIEAHEQGKDIDLNKVKTRTAAKYGLSAQPRLVDI
IAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIDQLKQLGHSVDKVEFIVMGGTFMALSEE
YRDYFIRNLHDALSGHTSNSVSEAVRYSERSLTKCIGITIETRPDYCLKRHLSDMLSYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNVGLERDIEQ
FTEFFENPAFRPDGMKLYPTLVIRGTGLYELWKSGRYKSYSPSCLVELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEESFRPELKGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAKQEHGAQKIAVISGVGTRNYYRKIGYVLEGP
YMVKQLN
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaacggaaaggagatctcagcccagctgagctgatgatattaaccattggt
gatgttataaaacaactaattgaagctcatgagcagggaaaagatatcgatctaaataaa
gtgaaaaccagaacagctgccaaatatggcctttcagcccagcctcgtctggtggatatc
attgctgcagtcccacctcagtatcgtaaaatcttggtgcccaagttaaaagcaaaacca
atcagaactgccagtgggattgctgttgtggctgtaatgtgcaaaccccacagatgtcca
catattaattttacaggaaatatatgtgtttactgccctggtggacctgactcagatttt
gagtattcaactcagtcttatactggatatgagccaacctctatgcgagctatccgtgcc
aggtatgacccttttctccagacaaggcaccgaatagatcagttgaaacaactaggtcac
agtgtggataaggtagaattcattgtgatgggtggaacatttatggccctctcagaagag
tacagagattattttatccgaaatttacacgatgctttatctggacatacttccaatagt
gtatcagaagcagtcaggtactctgaaagaagcctcacaaaatgcattggaatcaccatt
gaaacacgaccagattattgcctaaagaggcatttaagtgatatgttatcttatggctgt
acaagactggagatcggagtacaaagtgtttacgaagatgtagccagagataccaacagg
ggccacacggtaaaggcagtgtgtgaatcatttcatctggctaaggatgcaggtttcaaa
gttgtggcacatatgatgccagatttgccaaatgtaggactagaaagagacattgaacag
tttacagagttttttgagaaccctgccttccgccctgatggtatgaagctctaccctacc
ctggtaatacgtggaactggtctttatgaactttggaaatctggaagatataaaagttat
tctcctagttgccttgtagaattagtagctcgaatattggctcttgtaccaccctggaca
cgagtgtatcgagtgcagagagatatcccaatgcctttagtcagctcaggggtggagcat
gggaatttgagagagctggcatttgcaagaatgaaagaccttgggatacagtgtcgtgat
gtgagaaccagagaggttggaatccaggaaattcatcacaaagtgaggccataccaggtt
gaattagttaggagagattatgtagcaaatggtggctgggagacctttctatcatatgag
gaccctgagcaggacattctgattggccttctacgtttgcggaagtgctcagaggaatcg
tttcgacctgagttgaaaggaggtgtttctatagtccgagaactacatgtatatgggagt
gtggttcctgtgagcagtcgtgaccctacaaaatttcagcatcagggatttggtatgtta
ctcatggaagaagcagaaaggatagctaaacaagaacatggagctcagaaaattgctgtc
atttcaggagttggtaccaggaattactacaggaagatcggctatgtattagaaggacca
tacatggtaaagcagctgaactaa

DBGET integrated database retrieval system