KEGG   Monodelphis domestica (opossum): 100033192Help
Entry
100033192         CDS       T01031                                 

Gene name
ADRA2B
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
mdo  Monodelphis domestica (opossum)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100033192 (ADRA2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100033192 (ADRA2B)
G protein-coupled receptors [BR:mdo04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100033192 (ADRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 441 aa AA seqDB search
MDSPEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRHTWCEVYLALDVLFCTSSIVHLCAISLDRYWSVSRALEY
NSKRTPRRIKGIILTVWLIAAFISLPPLIYKGDKGKKPGGRPQCKLNEEAWYILSSSIGS
FFAPCLIMILVYLRIYLIAKRRNRQGPHSKQAPGDGDTGPSAPVGTSIISKLPPSILPAV
GEANGHSKPPGEREGGEQMGDPTSPSTPPNQSSVGPEDGSQKQEEEEEEEEEEEEEEEEE
CGPPALPTSSPPQGTPNFQPPQGSQVLATLRGQVLLARGPASLGLQPWRRRTQMNREKRF
TFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPVIYTIF
NQDFRRAFRRILCRQWTQTAW
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggatagcccagagccctactctgttcaggccactgcagccatcgcagctgttatcacc
tttctcatccttttcaccatttttggcaatgccctagtcatcctggctgtgttgactagc
cgatcccttcgagccccacagaacttgttcctggtttccctggctgcagctgacatcttg
gtggctactctgatcatacccttttcattggccaatgaactgctgggatactggtacttc
cgacacacctggtgtgaggtctacctggccttagatgtccttttctgcacctcttccatc
gtgcacctgtgtgccatcagtctggatcgctactggtcagtgagccgagccctggagtac
aactccaagaggaccccccgaaggattaagggcattattctcactgtttggcttattgct
gccttcatctcgctgcccccactcatctacaagggagacaagggcaagaaaccaggaggt
cggccccagtgtaagcttaacgaagaggcctggtacatcctctcctccagcattggctcc
ttctttgcaccctgccttatcatgatcctggtctacttgcggatctacctgattgccaag
cgacgtaaccgccaggggccccatagcaagcaggcccctggtgatggagacactgggcca
tctgcccctgttggtacatctataatatctaagcttccaccctccattctcccagctgtg
ggtgaggccaatggacattccaaacctcctggagagagagagggaggggaacagatggga
gatcccacgtcaccttccacacctcccaaccagagttctgtggggccagaggatggcagt
cagaagcaagaggaggaagaggaagaagaggaggaggaggaggaggaggaggaagaagaa
tgtgggcctccagcccttccaacttcctctcctccccaaggaaccccaaactttcagcct
ccacagggttcccaggtgttagccacactcaggggccaggtactgttggcccgaggacct
gcctctctggggctacagccatggaggcgtaggacccagatgaaccgagaaaaacgcttc
acctttgtgctggctgtggtgattggggtctttgtcctctgctggtttcccttcttcttc
agctatagcctaggagccatctgcccccagcactgtaaggtccctcatggtctttttcag
ttcttcttctggattggctactgcaacagttctctcaaccctgtcatctataccattttc
aaccaggattttcgcagggccttccgcaggatcctttgtcgccaatggactcagacagct
tggtga

DBGET integrated database retrieval system