KEGG   Monodelphis domestica (opossum): 100033192Help
Entry
100033192         CDS       T01031                                 

Definition
alpha-2B adrenergic receptor-like
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mdo04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 441 aa AA seqDB search
MDSPEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRHTWCEVYLALDVLFCTSSIVHLCAISLDRYWSVSRALEY
NSKRTPRRIKGIILTVWLIAAFISLPPLIYKGDKGKKPGGRPQCKLNEEAWYILSSSIGS
FFAPCLIMILVYLRIYLIAKRRNRQGPHSKQAPGDGDTGPSAPVGTSIISKLPPSILPAV
GEANGHSKPPGEREGGEQMGDPTSPSTPPNQSSVGPEDGSQKQEEEEEEEEEEEEEEEEE
CGPPALPTSSPPQGTPNFQPPQGSQVLATLRGQVLLARGPASLGLQPWRRRTQMNREKRF
TFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPVIYTIF
NQDFRRAFRRILCRQWTQTAW
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggatagcccagagccctactctgttcaggccactgcagccatcgcagctgttatcacc
tttctcatccttttcaccatttttggcaatgccctagtcatcctggctgtgttgactagc
cgatcccttcgagccccacagaacttgttcctggtttccctggctgcagctgacatcttg
gtggctactctgatcatacccttttcattggccaatgaactgctgggatactggtacttc
cgacacacctggtgtgaggtctacctggccttagatgtccttttctgcacctcttccatc
gtgcacctgtgtgccatcagtctggatcgctactggtcagtgagccgagccctggagtac
aactccaagaggaccccccgaaggattaagggcattattctcactgtttggcttattgct
gccttcatctcgctgcccccactcatctacaagggagacaagggcaagaaaccaggaggt
cggccccagtgtaagcttaacgaagaggcctggtacatcctctcctccagcattggctcc
ttctttgcaccctgccttatcatgatcctggtctacttgcggatctacctgattgccaag
cgacgtaaccgccaggggccccatagcaagcaggcccctggtgatggagacactgggcca
tctgcccctgttggtacatctataatatctaagcttccaccctccattctcccagctgtg
ggtgaggccaatggacattccaaacctcctggagagagagagggaggggaacagatggga
gatcccacgtcaccttccacacctcccaaccagagttctgtggggccagaggatggcagt
cagaagcaagaggaggaagaggaagaagaggaggaggaggaggaggaggaggaagaagaa
tgtgggcctccagcccttccaacttcctctcctccccaaggaaccccaaactttcagcct
ccacagggttcccaggtgttagccacactcaggggccaggtactgttggcccgaggacct
gcctctctggggctacagccatggaggcgtaggacccagatgaaccgagaaaaacgcttc
acctttgtgctggctgtggtgattggggtctttgtcctctgctggtttcccttcttcttc
agctatagcctaggagccatctgcccccagcactgtaaggtccctcatggtctttttcag
ttcttcttctggattggctactgcaacagttctctcaaccctgtcatctataccattttc
aaccaggattttcgcagggccttccgcaggatcctttgtcgccaatggactcagacagct
tggtga

DBGET integrated database retrieval system