KEGG   Monodelphis domestica (opossum): 100033302Help
Entry
100033302         CDS       T01031                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04020  Calcium signaling pathway
mdo04022  cGMP-PKG signaling pathway
mdo04114  Oocyte meiosis
mdo04218  Cellular senescence
mdo04310  Wnt signaling pathway
mdo04360  Axon guidance
mdo04370  VEGF signaling pathway
mdo04380  Osteoclast differentiation
mdo04625  C-type lectin receptor signaling pathway
mdo04650  Natural killer cell mediated cytotoxicity
mdo04658  Th1 and Th2 cell differentiation
mdo04659  Th17 cell differentiation
mdo04660  T cell receptor signaling pathway
mdo04662  B cell receptor signaling pathway
mdo04720  Long-term potentiation
mdo04724  Glutamatergic synapse
mdo04921  Oxytocin signaling pathway
mdo04922  Glucagon signaling pathway
mdo04924  Renin secretion
mdo05010  Alzheimer's disease
mdo05014  Amyotrophic lateral sclerosis (ALS)
mdo05031  Amphetamine addiction
mdo05152  Tuberculosis
mdo05166  HTLV-I infection
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100033302 (PPP3R1)
   04310 Wnt signaling pathway
    100033302 (PPP3R1)
   04370 VEGF signaling pathway
    100033302 (PPP3R1)
   04020 Calcium signaling pathway
    100033302 (PPP3R1)
   04022 cGMP - PKG signaling pathway
    100033302 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100033302 (PPP3R1)
   04218 Cellular senescence
    100033302 (PPP3R1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100033302 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    100033302 (PPP3R1)
   04660 T cell receptor signaling pathway
    100033302 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    100033302 (PPP3R1)
   04659 Th17 cell differentiation
    100033302 (PPP3R1)
   04662 B cell receptor signaling pathway
    100033302 (PPP3R1)
  Endocrine system
   04922 Glucagon signaling pathway
    100033302 (PPP3R1)
   04921 Oxytocin signaling pathway
    100033302 (PPP3R1)
   04924 Renin secretion
    100033302 (PPP3R1)
  Nervous system
   04724 Glutamatergic synapse
    100033302 (PPP3R1)
   04720 Long-term potentiation
    100033302 (PPP3R1)
  Development
   04360 Axon guidance
    100033302 (PPP3R1)
   04380 Osteoclast differentiation
    100033302 (PPP3R1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100033302 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    100033302 (PPP3R1)
  Substance dependence
   05031 Amphetamine addiction
    100033302 (PPP3R1)
  Infectious diseases
   05152 Tuberculosis
    100033302 (PPP3R1)
   05166 HTLV-I infection
    100033302 (PPP3R1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100033302 (PPP3R1)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100033302 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 100033302
NCBI-ProteinID: XP_007476788
Ensembl: ENSMODG00000003614
Position
1
AA seq 181 aa AA seqDB search
MAQGSSTKVQKKGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPEL
QQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISN
GELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVD
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagggtagcagtacaaaagttcaaaaaaagggaaatgaagcaagctatcccctg
gaaatgtgctcacactttgatgctgatgaaattaaaaggctagggaagagatttaagaag
cttgatttggacaactctggttctttgagtgtggaagagttcatgtctttgcctgaattg
caacagaatccattagttcaacgagtaatagatatatttgacacagatggcaatggagag
gtagacttcaaagaattcattgaaggagtttctcagttcagtgtcaaaggagataaagaa
cagaaattaaggtttgctttccgaatctatgacatggataaagatggctatatttccaat
ggggagctcttccaggtgctgaagatgatggtggggaacaatctgaaagacacacaattg
caacaaattgtagacaaaaccataattaatgcagataaggatggagatggaagaatatcc
tttgaagaattctgtgctgttgtaggaggcctagatatccacaaaaagatggtggtagat
gtgtga

DBGET integrated database retrieval system