KEGG   Monodelphis domestica (opossum): 100033313Help
Entry
100033313         CDS       T01031                                 

Gene name
UGP2
Definition
UDP-glucose pyrophosphorylase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100033313 (UGP2)
   00052 Galactose metabolism
    100033313 (UGP2)
   00500 Starch and sucrose metabolism
    100033313 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    100033313 (UGP2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100033313 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 520 aa AA seqDB search
MEVLSTEIVMFGGEAGAGDLRKAMSQGGTSQFQEVIRQELELSVKKELEKILSTAPQNES
EHTKKDLEGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKL
VVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTD
EDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYA
SFYNSGLLDTLIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRA
DVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAI
DMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNL
YSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGK
NVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgctctcaacagagatcgtaatgttcggaggcgaggcgggtgcaggggatctt
cgcaaagcaatgtctcaaggtggtacttcccagttccaagaagtcatccgacaagagctg
gaattatcagtgaagaaggaactagagaaaatactttcaactgcaccacaaaatgaatct
gagcatactaaaaaagaccttgaaggatttcggaaattattccatagattcttacaagaa
aagggaccttccgtggattgggggaaaatccaaaggcctccagaggattcgattcaacct
tatgagaagataaaggccagaggcttacctgataatatatcttctgtcctgaataagttg
gtagtagtaaaactcaatggtggtttgggaactagcatgggttgtaaaggtcccaaaagt
ctgattggtgtgcggaatgaaaatacttttttggatctgacagttcaacaaattgagcac
ttgaacaaaacctacaatacagatgttcctcttgttttgatgaactcttttaacactgat
gaagatacaaaaaaaatacttcagaagtacaatcattgccgtgtgaaaatctacactttt
aatcaaagcaggtaccctagaattaataaggaatctttactgcctgtagcaaaggatgtg
tcttactcaggggaaaatacagaagcttggtatcctccaggtcatggtgacatttatgcc
agtttctacaattctggtttgcttgatactcttataggagagggaaaggaatacattttt
gtgtccaacatagataatttgggtgctacggtggatctgtatattcttaaccatcttatg
aatccacccaatggaaaacgctgtgaatttgttatggaagtcacaaacaaaacaagggca
gatgtaaagggtggtaccctcacacaatatgaaggcaaactgagattggtggaaattgct
caagtgccaaaagcccacgttgacgaattcaaatctgtatcaaaattcaaaatatttaac
acaaacaacctgtggatctcgctagcagcagtcaagagactgcaggagcaaaatgccatt
gatatggaaatcattgtcaatccaaagacattggatggaggtctaaatgttattcagttg
gagactgcagttggagctgctattaaaagttttgagaattctcttggcattaatgttccc
cgaagccgttttcttcctgttaaaaccacatctgatcttctacttgtgatgtcaaacctc
tacagccttaacgcaggatctttaacaatgagtgaaaagagagaatttcctactgtaccc
ttggtaaaattaggaagctcttttacaaaggtccaagattacctaaggaggtttgaaagt
atacctgatatgcttgaactggatcatcttacagtgtctggagatgtgacatttggcaaa
aacgtctcattaaagggaacggttatcatcatagcaaaccatggtgacagaattgatatc
cctcctggagctgtgttagagaataaaattgtatctggtaaccttcggatcttggaccac
tga

DBGET integrated database retrieval system