KEGG   Monodelphis domestica (opossum): 100144614Help
Entry
100144614         CDS       T01031                                 

Gene name
CES2.1
Definition
carboxylesterase 2-like protein 1
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mdo00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 550 aa AA seqDB search
MWKKTSQLPKVLIVGVLCLLISAQGHEADELIRNTEYGKVEGTQITIKELAKSVNIFLGI
PFAKPPIGALRFSPPQPLDSWSVVRNATSYPPMCLQDVTILRKLIKVLKLNIPVTTSSED
CLYLNIYVPDNTKEGTGLPVMVWIHGGGLIFGSASMYDGSVLSASQNVVVVTIQYRLGVL
GFFSTGDEYASGNWGYLDQVAALRWVQKNIAHFGGDPGRVTIFGESAGAMSVSSHVLSPM
SKGLFHRAIMESGVAILPGMLSTSSEAIICLVANLSACDNCGSASIIECLRNKTEEEMLA
ISKPFKIIPGVVDGQFFPKHPEELLATGTFHHVPSIIGVNNHEYGWFIPMALGISKFKEE
MSRESIREILLSPLMNISPEIVHEMMERYLGNTEDPKELRAQFQEMMGDLVFVSPALRVA
QHHQNSSSPVYFYEFQHRPSMFKGIKPDFVKADHGDELRFVFGGPLLGRATPEEKLFSQK
IMAYWANFARNGDPNGADLLYWPAYNENEEYLQLGLELAVGRNLKAEKMEFWLKSLPQKK
KDQLLGDHDY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagaagacttcccaactgcctaaggtcctgattgtaggggtcctgtgcctccta
atttcagcccaagggcacgaggctgatgagctcatcaggaacactgagtatggaaaagtt
gaagggactcaaatcactatcaaggagcttgccaaaagtgtcaatattttcttgggaatc
ccctttgccaaaccccccattggagctctgaggttttctcctccacaacccctggattca
tggagtgttgtgagaaatgcaacttcttatccacccatgtgtttgcaggatgtcactatc
ctaagaaaactgataaaggtcctgaaactgaacatccctgtgactaccagttctgaagac
tgtttgtacctcaatatctatgttcctgacaacacaaaggaagggactggattaccagtg
atggtatggatccatggtggtggcctcatttttggctcagcctccatgtatgatggctca
gtattgtctgcatcccagaacgtggtggtggtcactatccagtacaggctgggtgttctc
ggattctttagcactggggatgagtatgcgtcaggcaactggggttacctggatcaggtg
gctgcccttcggtgggtccagaagaacatcgcccactttgggggagaccctggccgtgtc
accatttttggcgagtctgctggggcaatgagcgtttcttcacacgttctgtctcccatg
tccaaaggcttattccacagagcaatcatggagagcggtgtggccatccttcctggcatg
ctttctaccagctctgaagcaattatatgcctcgttgccaatctatctgcttgtgataat
tgtggttctgcctccataattgagtgcttaagaaacaaaactgaagaggagatgctggct
attagcaagccttttaaaataatccctggagtggttgatggccagttcttccccaaacat
cctgaagagcttttggccactggaacattccaccatgtccccagcattattggtgtcaac
aaccatgagtacggttggttcattcctatggccttgggtatctctaagttcaaagaagag
atgagtagagaaagcatcagagaaatacttctaagcccactcatgaatatttctcctgaa
attgtacacgaaatgatggaaaggtatttaggaaatactgaggatcccaaagaactccga
gcgcaattccaggagatgatgggggacttagtctttgttagtcctgccctccgagtggcc
caacaccatcagaattccagctctccagtctacttttatgaatttcagcaccgaccaagc
atgtttaagggcatcaaaccagactttgtgaaagcagaccacggcgatgagctgcgtttt
gtctttggaggaccccttttaggtagagcaacaccagaggaaaaactattcagccagaag
ataatggcctactgggcaaactttgcccgaaatggggacccaaatggtgcagacctgctc
tactggccagcctacaacgagaatgaagagtacttgcagctgggcctggagctggctgtg
ggaaggaacctgaaggcagaaaagatggagttctggctgaagagtttgcctcagaagaag
aaggaccaactattgggagatcatgactactga

DBGET integrated database retrieval system