KEGG   Monodelphis domestica (opossum): 100144615Help
Entry
100144615         CDS       T01031                                 

Gene name
CES1
Definition
carboxylesterase 1
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100144615 (CES1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100144615 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 563 aa AA seqDB search
MWLLSLVLCSLTAISIQGKQSSTPVVNTQYGKVRGKCESLKEFGKTVNIFLGVPFAKAPL
GPLRFTPPQPAEPWDYVKNTTTYPPMCAQDPVAGQLLSDLFTNRDEKISLKISEDCLYLN
IYTPADLSKKIKLPVMVWIHGGGLLVGAASTYDGLALSALENVVVVAIQYRLGIFGFYST
GDEHARGNWGYLDQVAALQWVQDNIANFGGDPSSVTIFGESAGGVSVSALVLSPLAKDLF
HRAISQSGVALTECLYNSSIMAATEKITTFAGCKTITSASMVHCMRQKSEEQLLDAGLEL
GLFGLDFLGDPLEKISFIPGVIDGVFLPKSPEELLAEKKFNHVPFIIGINNHEFAWILPT
LMEFPFSDGLPDQETARNLLWSTYPLVQIPKDRIPIIIKEYLGMIIDPIKMQDQFVNLMG
DLIFGIPSVRLARFHKASGAPTYMYEFQHRPSFSDNLKPEKVMADHGDEIFSVFGAPFLK
EDSPGKEKKLSRTVMKYWANFARNGNPNGEGLPKWPPYNQNEDYLQINITLQVGKRLKEK
EVKFWTEVMSKKPDEMKREHIEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgctttccctggtcctctgctccctcactgctatctccattcaggggaagcag
tcctcaacacctgtagtgaacactcaatatggaaaagtccgaggcaaatgtgaaagtcta
aaagaatttggcaaaactgtcaacattttcctgggggtcccttttgccaaagcccctctt
ggacccctgagatttaccccaccacagcctgcagaaccatgggactatgtgaagaacaca
actacttacccacccatgtgtgcccaggacccagtggctggacaattactctctgacctt
tttaccaatcgggatgaaaaaatttccttgaaaatatctgaagactgtttatacctaaac
atttatacccctgctgacctatcaaagaagatcaagttacctgtgatggtatggatccat
ggagggggtttactggtgggtgctgcatccacctatgatgggctggccctctcagccctt
gagaatgtggtggtagtggcaattcagtatcgcctgggaatctttggattctatagcact
ggcgatgaacatgcccgaggaaactggggttatttagatcaagtggctgcactccagtgg
gttcaggacaacattgccaattttggaggagacccaagctcagtcaccatctttggggag
tcagcaggaggtgtcagtgtttcagccttggttttatctcctttggccaaggaccttttt
catcgggctatttctcagagtggagttgccttaacagagtgtctgtacaattccagcatc
atggcagcaactgagaaaattacaacttttgctgggtgtaaaacaatcacttcggccagt
atggttcattgtatgaggcaaaagtcagaggagcaactcctggatgcaggtctggaattg
ggattattcgggctggatttcctgggtgaccccttggagaaaatttctttcatacctgga
gtcattgatggagtatttttacctaaaagtcctgaagagctcctggctgaaaagaagttc
aatcacgttccctttatcataggaatcaacaatcatgaatttgcctggattctcccaact
ctgatggagttccctttctcagatggcctaccagaccaagaaacagcaagaaacctatta
tggagcacctacccacttgttcaaatccccaaagaccgtattcctattataattaaggaa
tatcttggaatgataatagatcctatcaaaatgcaagaccaatttgtgaacttgatggga
gacttgatatttggaattccatccgtgaggttggctagatttcacaaagcatcaggtgca
cccacgtacatgtatgaatttcaacataggccaagcttctcagataacttgaaaccagaa
aaagtgatggcagaccatggggatgaaattttctctgtctttggggctccatttttgaaa
gaagattctccaggaaaagagaagaaacttagcaggacagtgatgaaatactgggccaac
tttgctcggaatggaaatcctaatggggaaggactgccaaaatggcctccttataatcag
aatgaagactacctccaaattaatatcaccctccaagtaggcaaaaggctgaaggagaaa
gaagtgaaattttggactgaggtcatgtcaaagaagccagatgagatgaagagagaacac
attgagctttaa

DBGET integrated database retrieval system