KEGG   Monodelphis domestica (opossum): 100144615Help
Entry
100144615         CDS       T01031                                 

Gene name
CES1
Definition
carboxylesterase 1
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mdo00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 563 aa AA seqDB search
MWLLSLVLCSLTAISIQGKQSSTPVVNTQYGKVRGKCESLKEFGKTVNIFLGVPFAKAPL
GPLRFTPPQPAEPWDYVKNTTTYPPMCAQDPVAGQLLSDLFTNRDEKISLKISEDCLYLN
IYTPADLSKKIKLPVMVWIHGGGLLVGAASTYDGLALSALENVVVVAIQYRLGIFGFYST
GDEHARGNWGYLDQVAALQWVQDNIANFGGDPSSVTIFGESAGGVSVSALVLSPLAKDLF
HRAISQSGVALTECLYNSSIMAATEKITTFAGCKTITSASMVHCMRQKSEEQLLDAGLEL
GLFGLDFLGDPLEKISFIPGVIDGVFLPKSPEELLAEKKFNHVPFIIGINNHEFAWILPT
LMEFPFSDGLPDQETARNLLWSTYPLVQIPKDRIPIIIKEYLGMIIDPIKMQDQFVNLMG
DLIFGIPSVRLARFHKASGAPTYMYEFQHRPSFSDNLKPEKVMADHGDEIFSVFGAPFLK
EDSPGKEKKLSRTVMKYWANFARNGNPNGEGLPKWPPYNQNEDYLQINITLQVGKRLKEK
EVKFWTEVMSKKPDEMKREHIEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgctttccctggtcctctgctccctcactgctatctccattcaggggaagcag
tcctcaacacctgtagtgaacactcaatatggaaaagtccgaggcaaatgtgaaagtcta
aaagaatttggcaaaactgtcaacattttcctgggggtcccttttgccaaagcccctctt
ggacccctgagatttaccccaccacagcctgcagaaccatgggactatgtgaagaacaca
actacttacccacccatgtgtgcccaggacccagtggctggacaattactctctgacctt
tttaccaatcgggatgaaaaaatttccttgaaaatatctgaagactgtttatacctaaac
atttatacccctgctgacctatcaaagaagatcaagttacctgtgatggtatggatccat
ggagggggtttactggtgggtgctgcatccacctatgatgggctggccctctcagccctt
gagaatgtggtggtagtggcaattcagtatcgcctgggaatctttggattctatagcact
ggcgatgaacatgcccgaggaaactggggttatttagatcaagtggctgcactccagtgg
gttcaggacaacattgccaattttggaggagacccaagctcagtcaccatctttggggag
tcagcaggaggtgtcagtgtttcagccttggttttatctcctttggccaaggaccttttt
catcgggctatttctcagagtggagttgccttaacagagtgtctgtacaattccagcatc
atggcagcaactgagaaaattacaacttttgctgggtgtaaaacaatcacttcggccagt
atggttcattgtatgaggcaaaagtcagaggagcaactcctggatgcaggtctggaattg
ggattattcgggctggatttcctgggtgaccccttggagaaaatttctttcatacctgga
gtcattgatggagtatttttacctaaaagtcctgaagagctcctggctgaaaagaagttc
aatcacgttccctttatcataggaatcaacaatcatgaatttgcctggattctcccaact
ctgatggagttccctttctcagatggcctaccagaccaagaaacagcaagaaacctatta
tggagcacctacccacttgttcaaatccccaaagaccgtattcctattataattaaggaa
tatcttggaatgataatagatcctatcaaaatgcaagaccaatttgtgaacttgatggga
gacttgatatttggaattccatccgtgaggttggctagatttcacaaagcatcaggtgca
cccacgtacatgtatgaatttcaacataggccaagcttctcagataacttgaaaccagaa
aaagtgatggcagaccatggggatgaaattttctctgtctttggggctccatttttgaaa
gaagattctccaggaaaagagaagaaacttagcaggacagtgatgaaatactgggccaac
tttgctcggaatggaaatcctaatggggaaggactgccaaaatggcctccttataatcag
aatgaagactacctccaaattaatatcaccctccaagtaggcaaaaggctgaaggagaaa
gaagtgaaattttggactgaggtcatgtcaaagaagccagatgagatgaagagagaacac
attgagctttaa

DBGET integrated database retrieval system