KEGG   Monodelphis domestica (opossum): 100144616Help
Entry
100144616         CDS       T01031                                 

Gene name
CES2.3
Definition
(RefSeq) carboxylesterase 2-like protein 3
  KO
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100144616 (CES2.3)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100144616 (CES2.3)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     100144616 (CES2.3)
    3.1.1.84  cocaine esterase
     100144616 (CES2.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 551 aa AA seqDB search
MWNTSVLPKALTLGVLCFLILVKGHKADDLIRTTESGQVQGTQISIKKLDKSVDVFLGIP
FAKPPIGALRFSPPQAPDSWNNVRDATSYPPMCLQDGLIQEKMEKALKIKLPRVAISEDC
LYLNIYVPGNTKEGDRLPVMVWIHGGGLVFGSASMYDGSILSASQNVIVVTIQYRLGVLG
FFSTNDEHAPGNWGYLDQVAALQWVQKNIAHFGGDPGRVTIFGESAGGTSVSSHVLSPMS
KGLFHRAIMESGVAILPGLIASSSDTVTNLVANLSACERSSSASMVQCLRSKSEEEMLAM
TKLFKIIPGVVDGKFLPRHPEELLAAGEFHHVPCIIGVNNHEYGWIIPAELGISELKEKM
DKGDIQSTVQGPLLGIPPELGHLMIEEYLGDIEDPRELRVQYQEMMGDLMFAIPALKVAK
YQHSSSSPVYFYEFQHRPSLFKDSKPDFVKADHGDELLFTFGWSLLGDTTEEEKVLSHKM
MSYWANFARHGNPNGADLLQWPAYDQNEEYMQLNLQLSVGKSLKGNKLEFWTKTVPQKMK
ESLLQKGRMEL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacacttccgtgctgcccaaggccctcactctgggggtcctgtgcttcctaatt
ttagtcaaagggcacaaggcagatgacctcatcaggaccaccgagtctggacaggttcaa
gggactcaaatcagcatcaagaagcttgacaaaagtgttgatgttttcctgggaatcccc
tttgccaaaccacccattggggccctgaggttttcccctccccaagcccctgactcctgg
aacaatgtgagagatgcgacttcttacccacccatgtgtttgcaggatggccttatacaa
gaaaaaatggaaaaggccttgaaaataaaactccccagggttgccatttctgaagactgt
ttgtacctcaatatctatgttcctggcaacacaaaggaaggggaccgattaccagtgatg
gtatggatccatggcggtggtctcgtttttggctcagcctccatgtatgatggctcgata
ttgtctgcatcccagaatgtgatagtggtcactatccagtacaggctgggtgttcttgga
ttctttagcactaatgatgagcatgcacctggcaactggggttacctggatcaggtagct
gccctacagtgggtccagaagaacattgcccactttggaggagatcctggccgtgtgacc
atctttggagagtctgcaggaggaacaagtgtctcctcacatgttctgtcccccatgtcc
aaaggtttgttccacagagcaatcatggagagtggtgtggccatccttcctggactgatt
gcttccagttctgacacagtcacaaatcttgttgccaatctgtctgcttgtgagagatcc
agttctgcctccatggttcagtgtcttcgaagcaaaagtgaggaggaaatgctggccatg
accaagcttttcaagataatccctggagtagttgatgggaaattcttgcccagacatcct
gaagagttgttggctgcaggagagttccaccatgtcccttgcatcataggtgtcaataac
catgaatatggttggattattcctgctgagttgggcatttctgaacttaaagaaaagatg
gataaaggagatatccaatcaacagtgcaaggtccactcttgggtattcctcctgagctt
ggccatttgatgattgaggagtatttaggagatattgaagatcctagagaacttagagtt
cagtaccaagaaatgatgggggatttgatgtttgctattcctgccctcaaagtggctaaa
tatcaacacagttccagctctccagtctacttctatgaatttcagcatcgaccaagcctg
tttaaagacagcaagccagattttgtgaaagcagaccatggcgatgagctgctttttacc
tttggatggtctcttttaggtgataccaccgaagaggaaaaagtcctgagccataagatg
atgagctactgggccaactttgcccgccatgggaacccaaatggtgcagacttattgcaa
tggccagcctatgaccagaatgaagagtatatgcagctgaatttgcagttgtctgtggga
aagagcctgaaggggaataagttagagttctggaccaagaccgtaccccagaagatgaag
gaatcactgctccaaaagggccggatggagttgtga

DBGET integrated database retrieval system