KEGG   Monodelphis domestica (opossum): 100617174Help
Entry
100617174         CDS       T01031                                 

Gene name
ST6GAL1
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 1
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00510  N-Glycan biosynthesis
mdo00514  Other types of O-glycan biosynthesis
mdo01100  Metabolic pathways
Module
mdo_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100617174 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    100617174 (ST6GAL1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     100617174 (ST6GAL1)
Glycosyltransferases [BR:mdo01003]
 Terminal extension
  Sialyltransferase
   100617174 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 100617174
NCBI-ProteinID: NP_001233154
Ensembl: ENSMODG00000013313
UniProt: E4ZFH4
Position
2
AA seq 401 aa AA seqDB search
MVHINFFRRIMYGLLAFLLFLTICLWNESKKGYSVSFRLDSKGFQLPRTLENLSRRLRTK
PVNITAMVGPQRESEAPRPRPKVDKFSYKVWDKDSSSKNLPARLQKVRKNYLHMNKYNVS
FEGTRQVEKLSTSGLLCQLANRVKVTMIQGTDFPFNTSEWEKSLPPKNIRESFGRLGTCA
VVSSAGSLKASYLGTEIDNHDAVLRFNGAPTKKYEEHVGKKTTFRLVNSQLVTTDKNFFD
DSLYKNGILIMWDPSPYHSEIPEWYKKPDYNFFHNYKLYRKLNPNQPFYILNPKMPWELW
DILQENSPEDIQPNPPSSGMIGIVIMMNFCDTVDIYEFLPSKRKTDICHYYQQFFDSACT
MGAYHPLLFEKNMVKHLNQGTDEDIYLKGKVTVPGLQGVRC
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggtccacatcaacttcttcagaaggattatgtatgggctcttggccttcctcctcttc
ctcaccatctgtctatggaatgaatccaagaaaggctactctgtttcctttagattagat
tccaaaggcttccagctgcccaggaccctggaaaacttgtctaggaggctgagaaccaag
cccgtgaacatcaccgccatggtgggcccccaaagagagagcgaggctccccgccccagg
cccaaggtggacaagttcagttacaaggtctgggataaggacagttcctccaagaacctc
cctgctcgcttgcagaaggtccggaagaactatttgcacatgaacaaatacaacgtgtcc
tttgaaggaacgcgccaggtggagaagctcagcaccagtggcttgctatgccagcttgcc
aatcgggtgaaagtcaccatgatccaggggactgacttccccttcaacacgtccgagtgg
gaaaagtctctcccgcccaagaatatccgggagagctttggaagactgggcacgtgtgcc
gtcgtctcatctgccggatccctgaaggcatcctacttgggtacagagatagacaatcat
gatgccgtcttgaggtttaatggggcacccacaaagaaatatgaagagcatgtaggaaag
aagacaacttttcgtctggtcaactctcagttggtcaccacagacaagaacttctttgat
gacagcctatataaaaatggaatcttaatcatgtgggacccctctccataccattcggag
atcccagagtggtacaagaaacccgactacaatttctttcataactacaagctatatcgc
aaactgaaccccaaccagcccttttatatcctcaaccccaagatgccatgggagctttgg
gacatcctccaggaaaattccccagaggacattcagcccaaccccccgtcctcagggatg
atcggtattgtgatcatgatgaacttctgcgacacggtggatatatatgaattcttgccc
tcaaagcgcaaaacagacatttgccactactaccagcagttctttgacagcgcctgcacg
atgggtgcttaccacccgctgctctttgagaaaaacatggtgaagcacctcaatcagggg
acggatgaggacatctacctgaaagggaaggtgacggtgccgggcttgcagggcgtccgc
tgctag

DBGET integrated database retrieval system