KEGG   Monodelphis domestica (opossum): 100617684Help
Entry
100617684         CDS       T01031                                 

Gene name
EIF4E1B
Definition
eukaryotic translation initiation factor 4E family member 1B
Orthology
K03259  
translation initiation factor 4E
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100617684 (EIF4E1B)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100617684 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    100617684 (EIF4E1B)
   04150 mTOR signaling pathway
    100617684 (EIF4E1B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100617684 (EIF4E1B)
Translation factors [BR:mdo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100617684 (EIF4E1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 216 aa AA seqDB search
MATAAPTVEDVQTETQVLEESPKERKLPLGEGLEKHPLENRWALWFFKNDRNRVWQDNLH
LVTKFETVEDFWAIHSHIKLASKLSSGCDYALFKDGIEPMWEDSRNKHGGRWLVSLAKQQ
RQSNLDRLWLETLLCLIGEAFEEYSEEVCGAVLNVRTKGDKIAIWTSEAENQPAVTFIGR
VYKERLGLSPKVIIGYQAHADTATKSNSFTKNKFVV
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctacagctgctccaacggtggaagatgtgcagactgaaacccaggtgctggaggag
tccccaaaagagaggaagttgcctcttggggaagggctggagaagcatcctttggagaac
aggtgggccttatggttcttcaagaatgacaggaacagagtttggcaagacaatcttcac
ctagttaccaagtttgagactgtggaggacttctgggcgatccacagccatatcaaactg
gccagcaaactgtcctcaggctgtgactatgcccttttcaaggatggcattgagcctatg
tgggaagatagcaggaacaaacatggtggccgatggctggtcagcttggccaagcaacag
cgtcaaagcaacctggatcggctctggctagagacgcttctttgtctgattggggaggcc
tttgaggagtacagtgaggaagtatgtggggctgtgctcaatgttcgcaccaagggggac
aagatagccatctggaccagtgaggctgagaaccagccagctgtcacctttattggacgt
gtctacaaggagaggctgggactctctccgaaggtcattattggctaccaggctcatgca
gacacagccaccaagagcaactctttcaccaagaacaaatttgtggtgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system