KEGG   Monodelphis domestica (opossum): 100618101Help
Entry
100618101         CDS       T01031                                 

Gene name
B3GALT4
Definition
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Orthology
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100618101 (B3GALT4)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100618101 (B3GALT4)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     100618101 (B3GALT4)
Glycosyltransferases [BR:mdo01003]
 Glycan extension
  Glycolipid
   100618101 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 373 aa AA seqDB search
MHPTMSFCLHPRCILLAAVTFLCIWAIFCPSEIRKELSCTPLMPAPAAPVPPLSLPHLLI
PNIGVCTGLGSPLFLLILVSSAPDHQEQRDAIRASWGALQEIQGYLVRTLFMLGEPSNSP
LENIKEVLKQEAQVKGDIVQAAFMDSYRNLTLKTLSGLAWAAQYCPDVHYVLKTDDDVYI
NVPGLVAELKQRGNDLKKDWQQRYLDRDGTAARSPNLPVPYLYLGHIHRRVYPSRSEYSR
HWVSEVQWPSARGPFPPYGSGTGYVLSAPVLRLILRAAGGVPLIPVEDVFIGVIAKRVGV
IPTHSIRIAGASRYPIDRCCFGRILLTSHHIEPWEMKDIWELVKSSSGNRPLCSWLQEAL
GMLRCWVIHHWHF
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctaccatgtccttctgccttcacccgcgctgcattctcctggcagctgtgaca
ttcttgtgcatctgggccatcttctgtccctctgagataaggaaggagctctcctgcact
cctctaatgccagctccagctgcacctgtgcccccactctccttgcctcaccttctgatc
cctaacataggagtttgcacaggtcttggttccccacttttccttctgattctggtgagc
tccgcgcctgaccaccaagagcagagagatgccattcgagcctcctggggggctctgcag
gagatccagggctacttggtccggacactcttcatgctgggggaacccagtaacagtcct
ttggaaaacattaaagaagtattgaaacaggaagcacaggttaagggggatattgtgcaa
gctgctttcatggactcctatcgaaaccttactctaaaaactctaagtggactggcatgg
gcagcccagtactgccctgatgtccattacgtcctcaagactgacgatgatgtctacatc
aatgtcccagggcttgtggctgagcttaagcaacgaggaaacgacctgaaaaaggactgg
caacagagatatctcgacagagatggaactgctgcccgtagcccgaatcttcctgtaccc
tacctgtacctaggccatattcatcggagagtctacccttcccggtcggagtacagccgg
cactgggtatcagaggtgcagtggccttctgcccggggtcccttcccaccctatggctca
ggcactggctatgtgttatcagccccagtcctgcggctgattctgagggcagctgggggt
gtgcctctgataccagtagaggatgtctttatcggggtgattgccaagagggtgggggtt
atccccacccacagcatacggatagcaggtgcctcccgctaccccatcgaccgatgctgc
tttgggaggatcttgctaacctctcaccatattgaaccctgggagatgaaggatatctgg
gagcttgtgaagagttcctcagggaataggccactctgctcctggctccaagaagccttg
ggaatgctaagatgttgggtgattcaccactggcatttttga

DBGET integrated database retrieval system