KEGG   Monodelphis domestica (opossum): 100618160Help
Entry
100618160         CDS       T01031                                 

Gene name
UNC13B
Definition
unc-13 homolog B (C. elegans)
Orthology
K15293  
protein unc-13
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100618160 (UNC13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 1569 aa AA seqDB search
MSLLCVRVKRAKFQGSPEKFNTYVTLKVQNVKSTTIAVRGDQPCWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEVCGTKNPTPHK
ILLDTRFELPFDIPEEEARYWTHKLEQINALGTDSEFSFQEESQKTLLPIAATQCSFEDP
DSAVDDRDSDYRSETSNSIPPPYHTTSQPNASVHQFSVPAHLQQHLFLQGSSRDSCNDSM
QSYDFDYPERRALSPTGSSRYGSSCNVSQGSSQLSELDQYHEHIHSSEQDDDHRERDSIY
SCHSTGSYTKDSQPGFGEQEKSLEGTSEAEKGRACEPKEMVKEDRTSHLPLELEPHKSPQ
ESYPEENHSSPFTQARAHWIRAVTKVRLQLQEAPDDGDPSRQLWLPSGSAGGLYGIDSMP
DLRKKKPLPLVSDLSLVQSRKAGITSALATRTSLKDEELKSHVYKKTLQALIYPISCTTP
HNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSK
HGAEDRTQNIIMAMKDRMKIRERNKPEIFDVIRDVFTVSKVAHAQQMKTVKQSVLDGTSK
WSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHN
SSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSA
VSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHHLTDIQGSGGVRIPEAKGDDAWKVY
FDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTA
STNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLL
TSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSHQYQTEKQELPPE
EQGPSIRNLDFWPKLITLIVSIIEEDKNAYTPVLNQFPQELNVGKVSAEVMWHLFAQDMK
YALEEHEKNRLCKSADYMNLHFKVKWLHNEYVRDLPALQGKVPEYPAWFEQFVLQWLDEN
EDVSLEFLHGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPGILAH
YMRRFAKTIGKVLMQYADILARSFPSYCDKEKLPCILMNNVQQLRVQLEKMFEAMGAKEL
DPEAGDNLKELQVKLNTVLDELSTVFGNSFQIRIDECVRQMADILSQVRGPANVPPNARG
SVAQDADSVLRPLMDFLDSNLTLFATVCEKTVLKRVLKELWRVVMNTMEKMIVLPPLTDQ
TGPQLIFTAAKELSHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKFANPVHDGKGIRF
TANEDIQPEKGSGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFV
EVTMVGPHQSDRKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPDAYELQVCVKDYCFARE
DRVLGLAVMPLREMAAKGSCACWCPLGRKVHMDETGLTILRILSQRSNDEVAREFVKLKS
ESRSSEEGS
NT seq 4710 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctctgtgtgcgggttaaaagagccaaattccagggttcaccagagaaattt
aatacatatgtgaccctgaaagtacaaaatgtgaagagcacgaccattgcagttcgaggg
gatcaaccttgctgggaacaagatttcatgtttgagatcagtcgcctggacctgggttta
agtgtagaagtatggaacaaaggcctgatttgggacacaatggtgggtactgtgtggatt
gcactgaagaccatccggcaatcagatgaggaaggccctggggagtggtccaccctggaa
gcagaaacattaatgaaagatgatgaagtctgtggaaccaaaaacccaactccccataaa
attttgctagatacaagatttgaattgccttttgatattccagaagaagaagccagatac
tggactcacaaactagaacaaatcaatgctctggggactgacagtgagttttcctttcaa
gaagaaagccagaagacgctattgcccattgctgccacccagtgttcttttgaggatcct
gatagtgctgtggatgatcgagacagtgactaccgcagtgagaccagcaacagcattcct
cctccctatcataccacttcccagcccaatgcctctgttcaccagttctcagtgccagcc
cacctgcagcagcatctgttccttcagggcagttctcgggactcctgcaatgactccatg
cagagctatgacttcgattacccagagcggagggccctcagccccactggcagtagtagg
tatggatcctcctgtaatgtaagtcaaggaagctcacagcttagtgagctggaccagtat
catgagcacattcatagctcagagcaagatgatgaccaccgagaaagggactcaatttat
tcctgccacagtactggaagctacacaaaggatagccaaccaggctttggggaacaggag
aaatcgttggaggggaccagtgaagctgagaagggaagagcttgtgagccaaaggaaatg
gttaaagaagatagaacgtctcatcttcccctagaactagagccacataaaagtccccag
gagagttatcctgaggagaatcattcttcaccatttacccaagctagagcacattggatt
cgagcagttaccaaagtccggctccaactccaagaggctcctgatgatggtgacccctcc
aggcagctgtggctccccagtgggtcagctggtggcctctatggtattgacagcatgcca
gacctacgcaaaaagaaaccacttccccttgtcagtgacttgtcattggtccagtcccgg
aaggcaggaatcacttctgcattggctacacggacctccctcaaagatgaagaactgaaa
tctcatgtatacaagaaaactctgcaagccttgatctaccctatctcatgtaccactcct
cacaactttgaggtgtggacagccaccacacccacctactgctatgaatgtgaaggcctt
ctatggggcattgcccggcaaggtatgcgttgcacagaatgcggggtgaagtgtcatgag
aagtgccaggacctgctcaatgctgactgcctgcaaagggcagcagagaaaagctccaag
catggagctgaggaccggactcagaatatcatcatggcaatgaaggatcgcatgaaaatc
cgtgagcgaaataagccagaaatttttgatgttatccgagatgtctttactgtaagcaaa
gttgcccatgcccagcagatgaaaacagtgaaacagagtgtgctagatggtacctccaaa
tggtcagccaagattacaatcactgtggtgtgtgctcaaggtctgcaggcgaaagataag
actggctccagtgatccttatgtcaccgtgcaagttggaaaaacaaagaaaagaacaaag
accatttttggcaacttgaatcctgtttgggaggagaagttccattttgagtgccataac
tcctcagaccgaatcaaggtacgagtatgggatgaggatgatgacatcaagtcaagagtg
aagcagcggctgaagcgggagtcagatgactttcttggccaaactattattgaagtgcga
accctgagtggcgagatggatgtctggtataacttggaaaagaggacagataaatctgct
gtctcaggggcaatccggctgcatatcagtgtggaaataaagggggaagagaaagtagca
ccatatcatgtacaatatacctgtctccatgagaacctgttccatcatctcacagacatc
cagggcagtggaggagtccggatccctgaggccaaaggggatgatgcatggaaggtttat
tttgatgaaacagcccaagaaattgtggatgaatttgccatgcgctatggcattgaatca
atataccaggccatgacgcactttgcatgtctgtcctccaagtacatgtgtcctggtgta
ccagcagtgatgagcactctgcttgccaacatcaatgcttactatgcccataccacagcc
tctaccaacgtctctgcctctgaccgttttgcagcctctaactttggaaaagagagattc
gtgaaactgctggaccagctgcataactcactgcgaattgacctctccacataccggaat
aatttccccgccgggagcccagaaaggctgcaggacctgaaatccactgtagacctgctc
accagcattacattcttcagaatgaaagtacaagagcttcagagtccaccccgtgccagc
caggttgtgaaggactgcgtgaaggcctgtctgaattccacctatgaatacatcttcaac
aactgtcatgaactgtacagccaccaataccagactgaaaaacaggaactgcctccagag
gaacaaggccccagtatccggaatctggatttctggcccaagctcattactctcattgtg
tccatcatcgaggaagacaaaaatgcctacacacctgtcctgaaccagttccctcaggag
ctgaatgtgggcaaggtcagtgcagaagtgatgtggcatctatttgcccaggacatgaag
tatgcattggaagagcatgagaagaatcgactctgtaaaagtgctgactacatgaacctg
cacttcaaagttaagtggcttcacaatgaatatgttcgagatctacctgccctccaaggg
aaggtgcctgaatacccagcgtggtttgagcaatttgtgcttcaatggctggatgagaat
gaggatgtatccctggagttcctgcatggcgccttggagagagacaaaaaagatgggttc
caacagacatcagaacatgcactcttctcctgctccgtggtagatgtcttcacacagctc
aaccagagttttgaaatcatccggaagttggaatgcccagatcccggcatccttgctcat
tacatgcggaggtttgccaagaccattggaaaggtgctgatgcagtatgcagacatctta
gccaggagcttcccatcttattgtgacaaggagaaactgccctgcatcctaatgaacaat
gtgcagcaattgagagtccaactagagaagatgttcgaggccatgggggccaaggagtta
gatcctgaggcaggagacaacctgaaggaacttcaggtgaaactgaacacagttctagat
gagctcagcacagtatttgggaacagttttcagatacggattgatgagtgcgttcgacaa
atggctgatatcctgagccaggtgcgaggtccagcaaatgtgcctcccaatgcaagaggt
tcagtggctcaagatgcagacagcgtactccgacccctcatggacttccttgatagcaac
ctcacactctttgccacagtatgtgagaagacagtgctgaaacgtgtgttgaaggagctc
tggcgggtggtgatgaacaccatggagaaaatgattgttctgccaccacttacagaccag
acgggtccccagttgatcttcacagctgccaaagagctaagtcatctctctaaacttaag
gaccacatggtacgggaggagacccggaacctcaccccaaagcagtgtgctgttcttgac
cttgcattggataccatcaagtttgctaacccagtgcatgatgggaagggtattaggttt
actgcaaatgaggacatacagccggagaagggatcaggtgtggatgatccagtgggggag
gtctctatccaagtggatctgtttacacatcctggaactggggagcacaaggtcacagtg
aaagtggtggctgccaatgacctcaagtggcagacagcaggcatgttcaggccttttgtg
gaggtgaccatggttggcccacaccagagtgaccgaaaaagaaagttcacaaccaaatcc
aagagcaacaactgggctcccaagtacaatgagacatttcacttcctcttagggaatgaa
gaagggccagatgcctatgaacttcaagtatgtgtgaaagactactgctttgcacgtgag
gatcgggtgctggggctggcagtgatgccactgagagagatggcagccaaaggtagctgt
gcatgttggtgtcccctgggtcggaaggtccacatggatgaaacaggcctaactattctc
cggatcctgtctcagagaagcaatgatgaagtggcccgagagtttgtgaagctcaaatca
gaatctcgctcttcagaggaggggagttga

DBGET integrated database retrieval system