KEGG   Monodelphis domestica (opossum): 100618462Help
Entry
100618462         CDS       T01031                                 

Definition
histone deacetylase 8-like
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100618462
  Substance dependence
   05034 Alcoholism
    100618462
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100618462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 379 aa AA seqDB search
MQEAEEPSPPPRQPPLPPVYIYSPEYVRTCDSLAKVPKRASMVHSLIEAYELLKEMRVVK
PKVASMEEMASFHTDAYLQHLQKVSEEGDDEHPDSVEFGLGYDCPSTEGIFDYAAAVGGG
TITAAQCLIDGTCNIAINWAGGWHHAKKDEASGFCYLNDAVLGILHLRRKFDRILYVDLD
LHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIRDE
KYYQICRSVLKEVYAAFNPKAVVLQLGADTIAGDPMCSFNMTPVGLGKCLKYILQWQLAT
LILGGGGYNLANTARCWTYLTGVILGRTLSSEIPDHEFFTSYGPDYVLEITPSCRPDRNE
LHQIQHILNRITGNLKHVV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaggcagaggagccctcgccccctccgcggcagccgcctctgccccctgtctac
atctacagcccggagtatgtccgcacttgtgattcgctggccaaggtgcctaagagggcc
agcatggtgcattccctgatcgaagcctatgagctgctgaaggaaatgagggtagtgaag
cccaaagtggcctccatggaggaaatggccagcttccacacggacgcctatctgcagcat
ctccagaaggtcagtgaggaaggggatgacgagcaccctgactcagtggaattcggcctg
ggctatgactgccccagcacggagggcatatttgattatgcggccgctgtagggggcggc
accatcaccgcggcccagtgcttaattgacggaacatgcaatatagccattaactgggcc
ggaggctggcatcatgccaagaaggatgaagcttcaggcttctgttacctcaatgacgct
gtcctagggattttgcatttgaggaggaagtttgatcgcattctgtatgtggacttggac
ctgcatcacggagatggcgtcgaagacgctttcagtttcacttccaaagtcatgaccgtg
tctctgcacaaattctctccggggttttttccggggactggagatgtgtcagacgtgggc
ctcgggaaggggcggtattacagcgtcaacgtgcccattcaggatggcatacgggatgaa
aagtattatcagatctgtagaagtgtcctcaaggaagtctatgcagccttcaaccccaaa
gcagtggttctgcagttaggagccgataccatagctggggacccgatgtgttcatttaac
atgactccagtgggactcgggaagtgtcttaagtacatccttcagtggcagctggccacc
ctgatactgggaggaggaggttacaaccttgccaacacagcccgatgctggacatacttg
accggggtcatcctgggtagaacactgtcttctgagatcccagatcatgaatttttcact
tcatatggcccagattatgtgttagaaatcacccccagctgccggcctgaccgcaatgag
ctgcaccaaatccagcacatcctgaatcgaattacagggaacctgaagcatgtggtttag

DBGET integrated database retrieval system