KEGG   Monodelphis domestica (opossum): 100618537Help
Entry
100618537         CDS       T01031                                 

Definition
carboxypeptidase A1-like
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:mdo04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:mdo04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 419 aa AA seqDB search
MKGLLVLSAVLLVVFGKEDFSGHQVLRISAADEAQVEKVRELEKLEHLQLDFWRGPSQPS
TPIDVRVPFPSVQAVKVFLESHGIKYSIMIKDVQVLLKDEEEQMFAFKSRAHSTDTFSYA
TYHTLDEIYEFMDLLVAENPNLVSKIQIGNSYEGRPINVLKFSTGGTNRPAIWIDTGIHS
REWVTQASGVWFAKKITDDYGQDEQLTAILDSMDIFLEIVTNPDGFAYTHSKNRLWRKTR
SITAGSSCVGVDPNRNWDAGFGEAGASSNPCSETYRGKFANSEVEVKSIVDFVTNHGNIK
AFISIHSYSQLLLYPYGYTTTRVAHQSELDQLAKAAVENLASLYGTKYKYGSIITTIYQA
SGGTIDWTYNSGIKYSYTFELRDTGLYGFLLPAKQIVPTAQETWLGLMTIMDYTLKHPY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggctactggtcttgagtgctgtgctgctggttgtctttggcaaggaggacttt
tcagggcaccaagtgctccgaatctcagcagctgatgaggctcaggtagagaaggtgagg
gagctagagaagctggaacatcttcagctggacttctggcgtggtccctcccaaccctcc
acccccatcgatgtccgtgtgcccttccccagtgtccaagctgtcaaagtgttcctggag
tcccacggcatcaagtattccatcatgatcaaggatgtgcaggtgctgctgaaggatgaa
gaggaacagatgtttgccttcaaatcaagggcacactccacagacaccttcagttatgcc
acctaccacactctggatgagatctatgaatttatggatctgcttgtggctgagaacccc
aaccttgttagtaagattcaaattggcaacagctacgaaggtcgccccatcaatgttctg
aagttcagtactgggggaaccaatcgtcctgccatctggattgacactggcatccattcc
cgagaatgggtcacccaggccagtggagtttggtttgctaagaagatcactgacgactat
ggccaagatgagcagctcactgccatcctggattctatggacatcttcctagagattgtc
accaaccccgatggttttgcctacacccactccaagaaccgtttgtggcgtaagaccagg
tccattacagctggatccagctgtgttggagtggatcccaacaggaactgggatgctggc
tttggagaggctggagccagcagcaacccttgttcagagacttaccgaggcaagtttgca
aactcagaagtggaggtcaagtccattgtagacttcgtgacaaaccatgggaacatcaag
gctttcatttccatccatagctactctcaactcctcctctacccctatggctacaccaca
acccgagttgcccatcaatcagagctggatcagctggccaaagctgcagtggaaaacctg
gcttctctgtatgggaccaagtacaagtatggcagcatcatcactactatctaccaagcc
agtggtggcaccattgactggacctacaactcaggcatcaagtactcttatacttttgag
ctccgggacaccggcctctatggtttcctgctgcctgccaaacagatagtccctactgcc
caggagacctggctgggtctgatgaccattatggattatactctgaagcatccttattaa

DBGET integrated database retrieval system