KEGG   Monodelphis domestica (opossum): 100618895Help
Entry
100618895         CDS       T01031                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01522  Endocrine resistance
mdo04010  MAPK signaling pathway
mdo04012  ErbB signaling pathway
mdo04014  Ras signaling pathway
mdo04024  cAMP signaling pathway
mdo04068  FoxO signaling pathway
mdo04071  Sphingolipid signaling pathway
mdo04137  Mitophagy - animal
mdo04140  Autophagy - animal
mdo04141  Protein processing in endoplasmic reticulum
mdo04210  Apoptosis
mdo04215  Apoptosis - multiple species
mdo04217  Necroptosis
mdo04310  Wnt signaling pathway
mdo04380  Osteoclast differentiation
mdo04510  Focal adhesion
mdo04530  Tight junction
mdo04620  Toll-like receptor signaling pathway
mdo04621  NOD-like receptor signaling pathway
mdo04622  RIG-I-like receptor signaling pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04657  IL-17 signaling pathway
mdo04658  Th1 and Th2 cell differentiation
mdo04659  Th17 cell differentiation
mdo04664  Fc epsilon RI signaling pathway
mdo04668  TNF signaling pathway
mdo04722  Neurotrophin signaling pathway
mdo04723  Retrograde endocannabinoid signaling
mdo04728  Dopaminergic synapse
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04910  Insulin signaling pathway
mdo04912  GnRH signaling pathway
mdo04914  Progesterone-mediated oocyte maturation
mdo04917  Prolactin signaling pathway
mdo04920  Adipocytokine signaling pathway
mdo04926  Relaxin signaling pathway
mdo04930  Type II diabetes mellitus
mdo04931  Insulin resistance
mdo04932  Non-alcoholic fatty liver disease (NAFLD)
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo05132  Salmonella infection
mdo05133  Pertussis
mdo05142  Chagas disease (American trypanosomiasis)
mdo05145  Toxoplasmosis
mdo05152  Tuberculosis
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05164  Influenza A
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
mdo05168  Herpes simplex infection
mdo05169  Epstein-Barr virus infection
mdo05200  Pathways in cancer
mdo05210  Colorectal cancer
mdo05212  Pancreatic cancer
mdo05231  Choline metabolism in cancer
mdo05418  Fluid shear stress and atherosclerosis
Module
mdo_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100618895 (MAPK10)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100618895 (MAPK10)
   04010 MAPK signaling pathway
    100618895 (MAPK10)
   04012 ErbB signaling pathway
    100618895 (MAPK10)
   04310 Wnt signaling pathway
    100618895 (MAPK10)
   04668 TNF signaling pathway
    100618895 (MAPK10)
   04068 FoxO signaling pathway
    100618895 (MAPK10)
   04071 Sphingolipid signaling pathway
    100618895 (MAPK10)
   04024 cAMP signaling pathway
    100618895 (MAPK10)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100618895 (MAPK10)
   04137 Mitophagy - animal
    100618895 (MAPK10)
  Cell growth and death
   04210 Apoptosis
    100618895 (MAPK10)
   04215 Apoptosis - multiple species
    100618895 (MAPK10)
   04217 Necroptosis
    100618895 (MAPK10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100618895 (MAPK10)
   04530 Tight junction
    100618895 (MAPK10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100618895 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100618895 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100618895 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100618895 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100618895 (MAPK10)
   04659 Th17 cell differentiation
    100618895 (MAPK10)
   04657 IL-17 signaling pathway
    100618895 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100618895 (MAPK10)
  Endocrine system
   04910 Insulin signaling pathway
    100618895 (MAPK10)
   04920 Adipocytokine signaling pathway
    100618895 (MAPK10)
   04912 GnRH signaling pathway
    100618895 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100618895 (MAPK10)
   04917 Prolactin signaling pathway
    100618895 (MAPK10)
   04926 Relaxin signaling pathway
    100618895 (MAPK10)
  Nervous system
   04728 Dopaminergic synapse
    100618895 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100618895 (MAPK10)
   04722 Neurotrophin signaling pathway
    100618895 (MAPK10)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100618895 (MAPK10)
  Development
   04380 Osteoclast differentiation
    100618895 (MAPK10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100618895 (MAPK10)
   05231 Choline metabolism in cancer
    100618895 (MAPK10)
   05210 Colorectal cancer
    100618895 (MAPK10)
   05212 Pancreatic cancer
    100618895 (MAPK10)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100618895 (MAPK10)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100618895 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100618895 (MAPK10)
   04931 Insulin resistance
    100618895 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100618895 (MAPK10)
  Infectious diseases
   05132 Salmonella infection
    100618895 (MAPK10)
   05133 Pertussis
    100618895 (MAPK10)
   05152 Tuberculosis
    100618895 (MAPK10)
   05164 Influenza A
    100618895 (MAPK10)
   05161 Hepatitis B
    100618895 (MAPK10)
   05160 Hepatitis C
    100618895 (MAPK10)
   05168 Herpes simplex infection
    100618895 (MAPK10)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100618895 (MAPK10)
   05169 Epstein-Barr virus infection
    100618895 (MAPK10)
   05145 Toxoplasmosis
    100618895 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    100618895 (MAPK10)
  Drug resistance
   01522 Endocrine resistance
    100618895 (MAPK10)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100618895 (MAPK10)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100618895 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2
Motif
Other DBs
NCBI-GeneID: 100618895
NCBI-ProteinID: XP_007495996
Ensembl: ENSMODG00000020770
Position
5
AA seq 464 aa AA seqDB search
MSRHFLSYFSEPTFDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccacttcttgtcctacttcagtgaacctaccttcgatgtgaaaattgccttt
tgtcagggatttgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagtagacaaccagttctacagtgtagaagtgggagattcaacgttcacagtt
ctcaaacgctaccagaatctaaagcctattggctctggggctcagggaatcgtttgtgct
gcatatgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccatttcag
aaccaaacacatgccaaacgggcttacagggagctggtcctcatgaagtgtgtgaatcat
aaaaatattatcagtttattaaatgtcttcacaccacagaaatcactagaagagttccaa
gatgtttaccttgtgatggaattgatggatgcaaacttgtgccaggtcattcaaatggaa
ttggaccatgagcgcatgtcttacctcctgtaccaaatgttatgtggcatcaagcacctt
cactctgctgggatcatccacagggatttaaagcccagtaacattgtggtaaaatctgat
tgcacattgaaaattctagactttggattggccaggactgcaggcacaagcttcatgatg
actccatatgtggtgacacgttattacagagccccggaagtcatcctgggaatgggctac
aaagagaatgtggatatatggtctgtaggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggattatattgaccagtggaacaaagtaattgagcaactagga
acaccatgcccagaattcatgaagaaattgcaacctacagtaagaaactatgtggagaat
cggcccaagtatgcaggccttactttccccaagctctttccggattccctcttccctgct
gactctgagcacaataaacttaaagccagccaagccagagaccttttgtccaagatgcta
gtgattgatccagccaaaaggatatcagtggatgatgccttacagcatccatacatcaat
gtctggtatgatcctgcagaagtggaggcgcctcctccacagatatatgataaacagctg
gatgaaagagaacataccattgaagaatggaaagaactgatctataaggaagtaatgaat
tctgaagaaaagactaaaaatggagtagtaaaaggacaaccttctccttcaggtgcagca
gtgaacagcagtgagagcctccctccatcctcttctgtcaacgacatctcctccatgtcc
actgaccagaccctggcatctgacactgacagtagcttggagacctcagcaggaccactt
ggttgttgcaggtga

DBGET integrated database retrieval system