KEGG   Monodelphis domestica (opossum): 100619033Help
Entry
100619033         CDS       T01031                                 

Definition
(RefSeq) thymosin beta-4
  KO
K05764  
thymosin, beta 4
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100619033
Cytoskeleton proteins [BR:mdo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     100619033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 44 aa AA seqDB search
MSDKPDMAEIQKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaagccagatatggctgagattcagaaattcgataagtctaaattgaagaag
acagaaacacaagagaaaaacccactgccttcaaaagaaacaattgaacaggagaagcaa
gcgggtgaatcgtaa

DBGET integrated database retrieval system