KEGG   Monodelphis domestica (opossum): 100619047Help
Entry
100619047         CDS       T01031                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100619047 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 588 aa AA seqDB search
MVKEINMADVDASTAASEAGAEDVSLFSITDMFLFSLIVGLLTYWFFFRKKKEEIPEFTK
IQTPAISSVKDSSFVEKMKKTGRNIVVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPE
EYDLADLGSLPEIDNSLAVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGN
KTYEHFNAMGKYVDNRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEA
TGEESSIRQYELVVHTDENMNKVYTGEMGRLKSYEXSRRPFDAKNPFLANVTANRKLNQG
GERHLMHLELDISNSKIRYESGDHVAVYPANDASLVTQLGEILGADLDVVMSLNNLDEES
NKKHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQYAAEPAEQEHLRKMASSSGEGKEL
YLSWVVEARRNILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAVV
VEYETKSGRLNKGVATNWLKAKEPALDNGHKATVPMFVRKSQFRLPFKPTTPVIMVGPGT
GIAPFMGFIQERAWLKGQGKGRRPPSPLPRPGSLRPELRPSPMYHQVL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagagatcaacatggcagacgtggacgccagcaccgccgcttccgaggctgga
gctgaggacgtttccctcttcagcataacagacatgtttctcttttccctcatcgtggga
ctgctgacttactggttcttcttcagaaagaaaaaggaggaaatccccgagttcaccaaa
attcagacaccggcgatctcttctgtgaaagacagcagctttgtggaaaagatgaagaaa
acgggcaggaacattgttgtgttttacggctcccagacgggcacggctgaagagtttgct
aaccgcctctccaaagatgcccaccgctacggcatgcgagggatggccgctgaccccgag
gagtacgacttggccgatttgggcagccttccagagatagacaactccctggcggtgttc
tgcatggccacctatggggagggagaccccaccgacaatgcccaggacttctatgactgg
cttcaagagacagatgtcgatctctcgggtgtcaagtttgcggtgtttggtcttgggaac
aagacctatgaacacttcaatgcgatggggaaatatgtggacaaccggctggagcagctg
ggcgctcagcgaatattcgagctaggcctgggtgatgacgatggaaacttggaggaagat
tttatcacctggagagaacagttctggcctgctgtttgtgaacactttggagtggaagct
actggtgaagaatccagcattcgtcagtatgagctggtggtgcacaccgacgagaacatg
aacaaagtgtacaccggggagatgggccgcctaaagagctacgagntttctcgcaggccg
tttgacgccaagaatccgttcctggccaacgtgaccgccaaccggaagttgaaccaggga
ggagagcgccacctcatgcacctggagctggacatctccaactccaagatcaggtacgag
tctggcgaccacgtggcggtgtacccggccaacgacgcctcgctcgtcacccagctcggg
gagatcctgggcgccgacctggacgtggtcatgtctctgaacaacctggacgaggagtcc
aacaagaagcacccgtttccctgccccaccacgtaccgcacggcactcacctactacctg
gacatcaccaacccgccccggaccaacgtcctctacgagctggcgcagtacgccgccgag
ccggccgagcaggagcatctccgcaagatggcgtcgtcgtcgggcgagggcaaggagctc
tacctgagctgggtcgtggaagcccggaggaacatcctggccatcctgcaggactacccc
tcgctgcggccccccatcgaccacctgtgcgagctgctgccccgcctgcaggcccgctac
tactccatcgcctcctcctccaaggttcaccccaactccatccacatctgcgccgtcgtc
gtggagtacgagaccaagtccggccgcctcaacaagggcgtggccaccaactggctgaag
gccaaggagccggccctggacaacgggcacaaggccacggtgcccatgttcgtgcgcaag
tcccagttccgcctgcccttcaagcccacaacgcccgtcatcatggtgggccccggcacc
ggcatcgcccccttcatgggcttcatccaggagcgggcttggctcaaaggccagggtaag
ggccggcgtcccccctcccccctcccccgcccggggtcccttcggccggaactcaggccc
tctcctatgtaccaccaggtactatga

DBGET integrated database retrieval system